Synaptic Protein Ubiquitination in Rat Brain Revealed by Antibody

Subscriber access provided by UIC Library

Article

Synaptic protein ubiquitination in rat brain revealed by antibody-based ubiquitome analysis Chan-Hyun Na, Drew R. Jones, Yanling Yang, Xusheng Wang, Yanji Xu, and Junmin Peng J. Proteome Res., Just Accepted Manuscript • DOI: 10.1021/pr300536k • Publication Date (Web): 07 Aug 2012 Downloaded from http://pubs.acs.org on August 10, 2012

Just Accepted “Just Accepted” manuscripts have been peer-reviewed and accepted for publication. They are posted online prior to technical editing, formatting for publication and author proofing. The American Chemical Society provides “Just Accepted” as a free service to the research community to expedite the dissemination of scientific material as soon as possible after acceptance. “Just Accepted” manuscripts appear in full in PDF format accompanied by an HTML abstract. “Just Accepted” manuscripts have been fully peer reviewed, but should not be considered the official version of record. They are accessible to all readers and citable by the Digital Object Identifier (DOI®). “Just Accepted” is an optional service offered to authors. Therefore, the “Just Accepted” Web site may not include all articles that will be published in the journal. After a manuscript is technically edited and formatted, it will be removed from the “Just Accepted” Web site and published as an ASAP article. Note that technical editing may introduce minor changes to the manuscript text and/or graphics which could affect content, and all legal disclaimers and ethical guidelines that apply to the journal pertain. ACS cannot be held responsible for errors or consequences arising from the use of information contained in these “Just Accepted” manuscripts.

Journal of Proteome Research is published by the American Chemical Society. 1155 Sixteenth Street N.W., Washington, DC 20036 Published by American Chemical Society. Copyright © American Chemical Society. However, no copyright claim is made to original U.S. Government works, or works produced by employees of any Commonwealth realm Crown government in the course of their duties.

Page 1 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Journal of Proteome Research

Synaptic protein ubiquitination in rat brain revealed by antibody-based ubiquitome analysis

Chan-Hyun Na1, Drew R. Jones1, Yanling Yang1, Xusheng Wang2, Yanji Xu2 and Junmin Peng1,2,3

1

Departments of Structural Biology and Developmental Neurobiology, 2St. Jude Proteomics

Facility, St. Jude Children's Research Hospital, Memphis, TN 38105, USA 3

Correspondence to Dr. Junmin Peng ([email protected])

Running title: Rat Brain Ubiquitome Analysis KEY WORDS ubiquitin, synapse, antibody, proteomics, mass spectrometry ABBREVIATIONS: LC-MS/MS: liquid chromatography with tandem mass spectrometry

1 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

SUMMARY Protein ubiquitination is an essential posttranslational modification regulating neurodevelopment, synaptic plasticity, learning and memory, and its dysregulation contributes to the pathogenesis of neurological diseases. Here we report a systematic analysis of ubiquitinated proteome (ubiquitome) in rat brain using a newly developed monoclonal antibody that recognizes the diglycine tag on lysine residues in trypsinized peptides (K-GG peptides). Initial antibody specificity analysis showed that the antibody can distinguish K-GG peptides from linear GG peptides or pseudo K-GG peptides derived from iodoacetamide. To evaluate the false discovery rate of KGG peptide matches during database search, we introduced a null experiment using bacterial lysate that contains no such peptides. The brain ubiquitome was then analyzed by this antibody enrichment with or without strong cation exchange (SCX) prefractionation. During SCX chromatography, although the vast majority of K-GG peptides were detected in the fractions containing at least three positive charged peptides, specific K-GG peptides with two positive charges (e.g. protein N-terminal acetylated and C-terminal non-K/R peptides) were also identified in early fractions. The reliability of C-terminal K-GG peptides was also extensively investigated. Finally, we collected a dataset of 1786 K-GG sites on 2064 peptides in 921 proteins and estimated their abundance by spectral counting. The study reveals a wide range of ubiquitination events on key components in presynaptic region (e.g. Bassoon, NSF, SNAP25, synapsin, synaptotagmin, and syntaxin) and postsynaptic density (e.g. PSD-95, GKAP, CaMKII, as well as receptors for NMDA, AMPA, GABA, serotonin, and acetylcholine). We also determined ubiquitination sites on amyloid precursor protein and alpha synuclein that are thought to be causative agents in Alzhermer’s and Parkinson’s disorders, respectively. As K-GG peptides can also be produced from Nedd8 or ISG15 modified proteins, we quantified these proteins in the brain and found that their levels are less than 2% of ubiquitin. Together, this study demonstrates that a large number of neuronal proteins are modified by ubiquitination, and provides a feasible method for profiling the ubiquitome in the brain. 2 ACS Paragon Plus Environment

Page 2 of 60

Page 3 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


INTRODUCTION Ubiquitin (Ub) is a small protein of 76 amino acids conserved in eukaryotic cells and functions as a posttranslational modifier to regulate nearly all cellular events1,2. The modification reaction is mediated by E1 activating, E2 conjugating, and E3 ligating enzymes, resulting in an isopeptide bond between the Ub C-terminal carboxyl group and the amine group on a lysine side chain or N-terminus of affected substrates3. Polyubiquitination of the substrates occurs by extending Ub chains through any of eight amino groups in Ub itself (M1, K6, K11, K27, K29, K33, K48 or K63)4-6. Alternatively, cysteine, serine and threonine residues are implicated as Ub conjugating sites but direct biochemical evidence (e.g. validation by mass spectrometry) is still missing7-9. Moreover, ubiquitination is reversible by the action of a large family of deubiquitinating enzymes (DUBs)10. Although initially discovered as a principle signal for proteasomal degradation, Ub plays fundamental roles in a variety of proteasome-independent processes, such as chromatin remodeling11, DNA repair12, endocytotic trafficking13, autophagy14, and immune defense15. The human genome encodes two Ub E1s, ~40 E2s, ~600 E3s and 95 DUBs16,17, generating the ubiquitinated proteome (ubiquitome) including thousands of protein substrates in different cell types and tissues. In addition, Ub like modifications have been found in eukaryotes (e.g. SUMO, Nedd8, and ISG15)18 and even in prokaryotes (e.g. Pup)19. The role of ubiquitin in neuronal development, synaptic plasticity, learning and memory is well recognized and its dysfunction may contribute to disease development20-23. For example, a number of E3 enzymes (e.g. Highwire, APC, SCF, Mindbomb, and TRIM3), DUBs (Fat facets/FAM, UCH-L1, UCH-L3, USP14), and proteasome play important functions in neuronal morphogenesis and synaptic formation23. Genetic mutations in Parkin E3 ligase and UCH-L1 are linked to Parkinson’s disease; UBE3A and ATXN3 are associated with Angelman syndrome and spinal cerebral ataxia, respectively23. Recently, mutations in UBQLN2, a Ub receptor regulating proteasomal degradation, have been shown to cause a rare type of familial amyotrophic lateral sclerosis24. Furthermore, Ub-positive inclusion staining is a pathological 3 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

hallmark in numerous neurodegenerative diseases, suggesting a critical role for Ub in disease development25. However, the investigation of ubiquitin pathways in neuronal regulation is limited by the lack of systematic tools to map the ubiquitome in the brain. With rapid development of mass spectrometry-based proteomics technologies26, large-scale analyses of the ubiquitome have become possible5. As trypsin digestion of ubiquitinated substrates generates signature peptides carrying a Gly-Gly (GG) tag on modified lysine residues (K-GG peptides), the resulting monoisotopic mass shift (+114.0429) is detectible by mass spectrometry27,28. However, because of low stoichiometry of protein ubiquitination in cells, pre-enrichment of the ubiquitome is essential for successful analysis. The ubiquitome has been purified by various approaches including Ub-binding domains, Ub antibodies, and epitopetagged Ub (e.g., FLAG, HA, myc, Strep, His, and biotin tag)29-36, but the analysis is still complicated by co-purified contaminants and difficulty in detecting K-GG peptides for modification site determination. Recently, a new strategy has been developed to directly enrich K-GG peptides instead of ubiquitinated proteins using monoclonal antibodies37-39. This strategy leads to the detection of up to 19,000 ubiquitinated sites in mammalian cell lines after accumulating ubiquitinated species by proteasomal inhibition. But its application to complex tissue samples has not been reported yet. In this study, we utilized this antibody enrichment strategy for analyzing the ubiquitome from rat brain. We also fully characterized the K-GG peptide antibody by pure proteins/peptides, and evaluated the target-decoy strategy for processing K-GG peptide matches during database search. Our study demonstrated that the antibody strategy provided a feasible method to detect many key ubiquitination events during neuronal regulation, and revealed a large number of unknown ubiquitinated targets for subsequent functional investigation.

EXPERIMENTAL PROCEDURES Generation of various GG peptides for antibody characterization 4 ACS Paragon Plus Environment

Page 4 of 60

Page 5 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


Iodoacetamide modification of ubiquitin was performed based on the protocol previously reported40. Purified mono-Ub was denatured in 8 M urea, and incubated with 50 mM IAA at 90°C for 20 min. The sample was cooled down to 4°C, diluted with 50 mM ammonium bicarbonate to reduce urea to 2 M, and digested with trypsin (30 ng/µl) at 37°C overnight. The resulting peptides were acidified by TFA (1%), desalted with Zip-Tip C18 (Millipore), and analyzed by LC-MS/MS. Genuine Ub K48-GG peptide was generated by digestion of K48 di-Ub (BostonBiochem), while M1-GG peptide and K48 peptide without GG tag were chemically synthesized. Finally, these samples were mixed to ensure similar levels (~5 picomoles) of pseudo-K48-GG, K48-GG, M1-GG peptides and K48 peptide without GG tag. The mixture was desalted, dried and subjected to enrichment by K-GG antibody coupled to protein A agarose beads (2 µl, Cell Signaling Technology). The flowthrough and elution were desalted for MS analysis (Q-Exactive, Thermo Scientific).

Escherichia coli peptide preparation E. coli DH5α strain was harvested and lysed in lysis buffer A (0.1 M Tris, pH 8.5, 8 M urea, 0.15% sodium deoxycholate). Approximately 80 µg of protein was digested with Lys-C (100:1 substrate-to-enzyme ratio) at 21°C for 1 h, diluted to 2 M Urea by a dilution buffer (0.1 M TrisHCl, pH 8.5, 0.15% sodium deoxycholate) and further digested by trypsin (100:1 ratio at 37oC overnight).

Rat brain peptide preparation and fractionation by strong cation exchange chromatography Adult Rat brain (Pel Freez Biologicals) was dissected to obtain cerebral cortex, excised with a razor blade and vortexed in the presence of a mixture of three different sizes of glass beads (0.5 mm, 1 mm and 5 mm in diameter, Sigma) in the lysis buffer A (above) until all the tissue was visibly lysed. The lysate was clarified at 15,000 x g at 4oC for 10 min, and quantified by BCA (Thermo Scientific). Brain protein (40 mg) was digested with Lys-C (1:200, 21°C, 30 min), 5 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

diluted to 2 M urea and digested by trypsin (200:1 ratio at 37oC overnight). The peptide sample was acidified, desalted with Sep-Pak C18 (Millipore), and eluted by 40% acetonitrile (ACN) plus 0.1% TFA. While half of the eluent was dried for direct K-GG antibody enrichment, the other half were dried and resuspended in SCX binding buffer (5 mM KH2PO4, pH 3, 25% ACN), loaded onto an SCX column (250mm×94 mm, polyLC), and eluted with a gradient from 18 to 38% of SCX elution buffer (5 mM KH2PO4, pH 3, 1 M KCl, 25% ACN) over 40 min at a flow rate of 1.5 ml/min. Peptide eluents were collected every minute and the solution charge state was determined by analyzing a fraction (10 µl) of each fraction. Based on the charge state analysis, fractions 5-15, 23-29, and 30-55 were pooled together, and the remaining fractions were analyzed separately.

Enrichment of K-GG peptides by immunoaffinity purification The enrichment was performed largely based on the manufacturer's protocol with some modifications. The SCX fractions were desalted, dried and dissolved in IAP buffer (50 mM MOPS/NaOH, pH 7.2, 10 mM Na2HPO4, 50 mM NaCl). The K-GG antibody beads (2 µg Ab per mg starting protein, 1 µg Ab per µl beads, Cell Signaling Technology) were incubated with the peptide solution at 4oC with gentle rotation for 30 min. The beads were then washed at 4oC with the IAP buffer plus 0.15% sodium deoxycholate three times, followed by 5 mM ammonium bicarbonate wash once. Gentle centrifugation (1500 × g for 15 sec) was used to separate beads from the solution. Captured peptides were eluted by 0.15% TFA at 21°C for 5 min, desalted with Zip-Tip C18 (Millipore) for LC-MS/MS analysis. In some cases, the unbound peptide sample was subjected to a second round of IAP and subjected to analysis as indicated.

Mass spectrometry analysis The peptide samples were analyzed either on LTQ-Velos Orbitrap (Thermo Scientific) coupled with Nano Acquity UPLC (Waters) or on Q-Exactive (Thermo Scientific) coupled with Easy-nLC 6 ACS Paragon Plus Environment

Page 6 of 60

Page 7 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


1000 (Thermo Scientific), and separated on a C18 reversed phase column (100 mm, 75 µm ID, 2.7 µm HALO beads, Michrom Biosources; buffer A: 0.1% formic acid; buffer B: 0.1% formic acid plus 70% AcN; 10-40% gradient in ~1 h for SCX samples or ~3 h for directly enriched KGG peptide samples; 0.3 µl/min flow rate). The LTQ-Velos Orbitrap settings included one survey scan (60,000 resolution in Orbitrap, 106 automatic gain control (AGC), and 500 ms maximal ion time), and top 20 low resolution MS/MS scans (5000 AGC, 250 ms maximal ion time, 3 m/z isolation window, default collision-induced dissociation, and 15 sec dynamic exclusion). The QExactive program was one survey scan (70,000 resolution, 106 AGC, 30 ms maximal ion time), followed by top 10 MS/MS scans (17,500 resolution, 105 AGC, 500 ms maximal ion time, 3 m/z isolation window, default higher-energy C-trap dissociation (HCD), and 15 sec dynamic exclusion). Charge state screening was enabled to exclude precursor ions with single charge or unassigned charge state. During the quantification of Ub, Nedd8 and ISG15, a targeted MS/MS method on Q-Exactive was used to assess protein abundance based on multiple peptides, similar to a previous analysis41. HCD collision energy was optimized using authentic standards. Heavy and light forms of each target peptide were multiplexed (n = 2) with an isolation window of 0.4 m/z and maximal ion time of 1000 ms. The relative isotopic abundance of heavy peptides to light standards was determined by measuring co-eluted peak area of the matching peptides (10 ppm tolerance) in high resolution (70,000) survey scans, and confirmed by the MS/MS spectra with known standard spectra.

Data processing and analysis Acquired MS/MS raw files were converted into mzXML format and searched by Sequest algorithm (version 28 revision 13) against a composite target/decoy database to estimate false discovery rate (FDR)42,43. The target protein database was generated by merging the NCBI reference and Uniprot rat databases (48,255 protein entries). The decoy protein database was 7 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

generated by reversing all target protein sequences. Spectra were searched with ±5 ppm for precursor ion mass tolerance, ±0.02 (Q-Exactive data) or ±0.5 (LTQ-Velos data) for product ion mass tolerance, fully tryptic restriction, dynamic mass shift for oxidized Met (+15.9949) and GGtagged Lys (+114.0429), three maximal missed cleavages, and four maximal modification sites. Only b and y ions were considered during the search. For combined modification analysis, additional dynamic mass shifts were +42.0106 on N-terminus for N-terminal acetylation, 89.0299 on N-terminus for N-terminal acetylation after Met removal, +0.9840 on Gln/Asn with partial tryptic restriction for deamidation, or +79.9663 on Ser/Thr/Tyr for phosphorylation. Assigned peptide spectra matches were first filtered by MS mass accuracy (±4 standard deviations, ~±1.4 ppm on Q-Exactive, which was determined by all empirical good matches of doubly charged peptides with Xcorr at least 2.5). These good matches were also used for global mass re-calibration prior to the filtering. The survived matches were grouped by precursor ion charge state and further filtered by Xcorr and Cn value. The cutoff values for XCorr and Cn were adjusted until a peptide FDR lower than 1% was achieved. In addition, all spectra of GG peptides with multiple modifications were manually validated. If one GG peptide was matched to multiple proteins, the peptide was represented by the protein with the highest spectral counts according to the rule of parsimony.

Quantification of Ub, Nedd8 and ISG15 in metabolically labeled mouse brain Mouse brain was labeled by stable isotope (K +6.0201 Da) using the metabolic labeling strategy in three generations41,44. Brain tissue was lysed as above and quantified by BCA (Thermo Scientific) and Coomassie staining on a short SDS gel45. Recombinant purified Ub, Nedd8 and ISG15 (Boston Biochem) were subjected to amino acid analysis (AAA Service Laboratory) to determine exact protein concentration. The free (12 KDa) of brain proteins were separated by loading onto a 9% Tris-glycine SDS gel. The standard proteins were mixed, run on a short SDS gel, excised and mixed with the gel bands corresponding to the 8 ACS Paragon Plus Environment

Page 8 of 60

Page 9 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


Ub/Nedd8 free and conjugated forms, respectively. The samples were in-gel trypsin digested (20 ng/μl trypsin, 37oC overnight), and analyzed by Q-Exactive MS (Thermo Scientific). The targeted data analysis was performed with Xcalibur software (Thermo Scientific).

RESULTS Neither M1-GG peptides nor iodoacetamide pseudo-GG peptides bind to the K-GG antibody. Among the two K-GG monoclonal Abs commercially available, the Ab from Lucerna was generated against GG-modified histone and was shown to distinguish K-GG peptides from M1GG peptides (linear peptide modified on the N-terminal amine group)37, the other from Cell Signaling Technology was produced against the sequence CXXXXXXKGGXXXXXX (X = any amino acid except Cys, Trp) but is not fully characterized38. As the latter Ab was made against more randomized antigens, we decided to use the Ab for our analysis. In addition, iodoacetamide (IAA), a common Cys alkylation reagent to inhibit DUB activity during purification, may react with Lys residue under high temperature to derive a mass-indistinguishable, pseudoGG tag40 (Fig. 1A). Therefore, we compared the binding of various peptides to this Ab (Fig. 1B, 1C). A mixture of comparable level of four types of peptides (M1-GG, pseudo-GG, Ub K48 GG, and Ub K48 without GG tag) was incubated with the Ab beads, followed by MS analysis of the flowthrough and eluent samples. Whereas the majority of Ub K48 GG peptide was bound to the beads, all other peptides showed trace amount of binding (less than 0.1%), indicating that the Ab has high specificity only to K-GG peptides.

Removal of false positive K-GG peptides by the target-decoy strategy Although the target/decoy strategy43 is a widely used method to filter false positive peptides, its use to control false discovery rate (FDR) for GG peptides has not been validated and some concerns has been raised, because the addition of dynamic modification dramatically increases the database search space46. Thus, we used E. coli total lysate as a negative control to evaluate 9 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Page 10 of 60

if the target/decoy strategy is suitable for data filtering, since the prokaryotic cells contain no Ub and the digested lysate has no GG peptides. All potential peptide matches were grouped by charge state, and then filtered stepwise by mass accuracy and matching scores (Xcorr and Cn) (Fig. 2A). As expected, in the dataset before filtering, we observed equal numbers of GG peptides matched to the target and decoy databases (n = 562), while more total peptides were matched to the target than the decoy databases, suggesting that about 3953 (n = 5613 – 1660) peptides were true positive non-GG peptides (Fig. 2B). We then tested the effect of precursor mass tolerance on FDR and accepted peptide numbers (Fig. 2C). With increased stringency for mass tolerance, the FDR was decreased but the number of accepted peptides was lower. We found that 1.4 ppm mass tolerance showed a good compromise between minimizing FDR and maximizing true positives. After filtering, more than half of the false positive GG peptides were removed. The remaining target and decoy GG peptides still showed almost equal numbers (209 versus 216) (Fig. 2D), and similar score distributions (Fig. 2E), suggesting that the mass accuracy filter showed no bias in removing false GG peptides in either the target or decoy databases. Moreover, we manually accepted highly reliable peptides (doubly charged peptides, XCorr at least 2.5)42 to analyze mass error of the LC-MS/MS platform. All data points were fitted to a Gaussian distribution with a standard deviation of ~0.35 ppm. Therefore, our selected mass tolerance was about 4 times the standard deviation, which theoretically included > 99.9% of true positives. Indeed, the 1.4 ppm threshold accepted 3863 (n = 4515 – 652) potential true matches (Fig. 2D) with a recovery rate of approximately 97.7% (3863/3953). Finally, the peptide matches were further filtered by dynamically adjusting XCorr and Cn until peptide FDR reached ~1%. While the vast majority of GG peptides were removed, leaving only 7 target and 5 decoy GG peptides (Fig. 2F), the true positive number was estimated to be 3621 (n = 3636 – 15), indicating a recovery rate of 91.6% (3621/3953).


Page 11 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


To further examine if the target-decoy strategy has a systematic bias in analyzing null experiment data (i.e. from E. coli) versus GG peptide containing samples, we merged raw data from a E. coli sample and a rat GG peptide enriched fraction, and filtered the data by mass accuracy. It was clear that the target GG peptides showed a different score distribution from the decoy GG peptides (Fig. 2G), indicating the presence of true positives in this mixed dataset. After XCorr and Cn filtering to ~1% peptide FDR, the decoy GG peptides from E. coli or Rat samples were almost eliminated (with only one remaining, Fig. 2H). Overall, these testing experiments demonstrated the effectiveness of the target-decoy strategy in data processing for GG peptides.

Analysis of rat brain ubiquitome with or without implementation of SCX fractionation Since SCX fractionation is able to decrease the complexity of complex peptide samples and is commonly used for complex protein mixture analysis, we attempted to implement SCX fractionation prior to the Ab enrichment (Fig. 3A). In addition, most tryptic peptides are doubly charged, but typical GG peptides are at least triply charged in SCX buffer, so the SCX column may allow for enrichment of GG peptides (Fig. 3B). Compared with the previously reported method, in which GG peptides were isolated directly from digested total cell lysate by multiple cycles of affinity pulldown38, we digested 40 mg of rat cerebral cortex protein and equally split the sample for testing both approaches. During the multiple cycles of Ab enrichment analysis, 915 GG peptides were identified out of 2172 total peptides in the 1st cycle, and only 99 GG peptides were identified out of 1923 total peptides in the 2nd cycle, indicating that the majority of GG peptides were recovered in the first round (Fig. 4A). In the SCX-Ab enrichment study, a total of 1769 GG peptides were identified out of 7453 total peptides. Pooling the data led to identification of 2064 GG peptides (1786 GG sites in 921 proteins, supplemental Table S1) with 637 GG peptides shared by both strategies (Fig. 4B). When examining the peptides identified in every SCX fraction, most of GG peptides were found in the fraction containing at least triply 11 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Page 12 of 60

charged peptides (fraction 17 and above, Fig. 4C). In addition, we did observe enrichment of GG peptides in several SCX fractions (e.g. 6-fold more enrichment in fraction 17 than fraction 16). However, some additional modifications (e.g. N-terminal acetylation before or after first Met removal, and phosphorylation) decrease the solution charge state of GG peptides and should be detected in early SCX fractions (Fig. 3B). Indeed, we performed dual modification search and found 37 N-terminal acetylated GG peptides, largely in the fractions with doubly charged peptides (fraction 5-15, Fig. 5A and 5B). Only one phosphorylated GG peptide was identified and was matched to integral membrane protein 2C (Fig. 5C). The reliability of this modification was supported by the detection of the same GG modification site (Lys20 residue) in a corresponding unphosphorylated counterpart (Table S1). Moreover, according to N-end rule for protein degradation47, some proteins are deaminated at the N-terminus during enzymatic modification. In our analysis, we identified three deaminated GG peptides (Fig. 5D). In summary, both the approaches with or without SCX enabled the identification of a large number of GG peptides in the brain tissue, and SCX fractionation improved GG peptide identification by approximately 2-fold.

Analysis of GG peptides modified on C-terminal Lys residues As GG modification of lysine residues leads to trypsin miscleavage5,48, GG peptides with Cterminal Lys modification (C-term GG peptides) derived from database search are considered as false positives38. In this large scale analysis, we sought to examine these 209 C-term GG peptides in detail and classified these peptides into different categories (Fig. 6A). First, 3 peptides were directly derived from proteins that end with Lys at C-termini, which showed wellmatched product ions during manual interpretation and were considered to be true positives (Fig. 6B). Then, we tested whether an internal K-GG modification was misassigned to a C-terminal Lys residue by database searching algorithms. 45 GG peptides without internal Lys were removed, and 36 peptides containing multiple GG tags were considered as false positives, as 12 ACS Paragon Plus Environment

Page 13 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


we noticed that the frequency of multiple GG modification is rare (0.4%, 9/2064) in our final dataset. Finally, we found that in the remaining 125 C-term GG peptides, unmodified internal Lys residues were positioned in the C-terminal region with much higher frequency (Fig. 6C). For example, 45, 24, and 24 peptides displayed a Lys residue right next to the C-terminus on -1, -2, and -3 positions, respectively, whereas only 7±3 peptides had Lys on other positions (-4 to -8). This C-terminal bias of internal lysine distribution was not observed in our large GG peptide dataset (Fig. 6D). This result strongly suggested that such GG sites were misassigned to Cterminal Lys instead of the adjacent Lys at -1, -2 or -3 position. Therefore we manually repositioned the GG sites for the 92 (n = 45+24+24) peptides. In addition, we noticed that 67% of the repositioned GG peptides were already identified by other MS/MS scans in the dataset, providing further evidence for this correction of misassigned K-GG sites.

The vast majority of GG peptides were produced from Ub modification The K-GG Ab enrichment analysis may be confounded because GG tags can be generated from Ub, Nedd8 or ISG15 modification. Therefore, we quantified the level of free and conjugated forms of the three proteins in rodent brain to evaluate their contribution to the pool of GG peptides by a targeted LC-MS approach. Highly purified recombinant proteins were used as internal standard to measure the level of these Ub family proteins in metabolically labeled mouse brain lysate (Fig. 7A). Based on the analysis of multiple peptides, we detected 111.6±6.9 picomoles of free Ub and 122.6±10.3 picomoles of conjugated Ub per mg total protein (Fig. 7B). Although we also detected 5.9±0.4 picomoles/mg of free Nedd8, the levels of conjugated Nedd8 or ISG15 were below the detection limit (~2.0 picomoles/mg), consistent with previous estimations38,49. Therefore, the level of conjugated Nedd8 or ISG15 in the brain was at least 60fold lower than that of ubiquitin, indicating that ubiquitination is credited for the vast majority of GG peptides.



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Page 14 of 60

Comparison the rat brain analysis with previously reported large datasets of ubquitome We compared our rat brain dataset (2,064 GG peptides) with three recent reported large datasets from human cell lines (totaling 27,318 GG peptides)38,39,50. Only 30.5% (631/2,064) of the brain peptides were overlapped with the reported studies, and 14.9% (308/2,064) of the rat peptides were homologous to the human counterparts (supplemental Table S2), showing conservation of ubiqutination sites in these two species. Importantly, more than half of our dataset (54.5%, 1,125/2,064) are novel, revealing ubiquitination events that may be specific to brain tissue.

The brain ubiquitome is dominated by a small group of highly modified Ub-conjugates We analyzed the abundance of individual proteins in the ubiquitome by spectral counting, the total number of MS/MS spectra matched a designated protein, which is commonly used as a semi-quantitative index during MS analysis51. While 539 (59%) out of 921 identified proteins had only 1-4 spectra counts, 18 (2%) proteins had spectra counts of more than 100, suggesting that the ubiquitome displayed a large dynamic range in protein concentration (Fig. 8A, 8B). The levels of seven polyUb linkages were also compared and ranked in a descending order of K48, K63, K11, K6, K33, K27 and K29 (Fig. 8C). This result is in good agreement with our previous measurement in mammalian cells based on stable isotope labeled GG peptides41, except that the K29 GG peptide was greatly underrepresented. The discrepancy in the K29 linkage levels was due to the loss of this hydrophilic K29 GG peptide (AK(GG)IQDK) during desalting and LC runs.

Analysis of synaptic proteins and Ub/Nedd8 pathway proteins in the dataset To evaluate the depth of this ubiquitome analysis, it is important to examine if we were able to identify previously known key ubiquitin substrates in the brain20-23. We identified 45 synaptic substrates (Fig. 9A), including 24 presynaptic proteins (e.g. Basson, NSF, SNAP25, Synapsin, 14 ACS Paragon Plus Environment

Page 15 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


Sv2, Synaptotagmin, Syntaxin, VAMP, and synuclein) and 23 postsynaptic components (e.g. PSD-95, GKAP, CaMKII, and receptors for NMDA, AMPA, GABA, serotonin, and acetylcholine). The consequence of these ubiquitination events may be linked to proteasomal degradation and membrane sorting. For instance, ubiquitination of AMPA receptor is proposed to regulate its degradation and trafficking52,53. In addition, as active Ub pathway proteins are often selfmodified by ubiquitination, we collected these Ub pathway proteins in our dataset, including Ub/Nedd8 and their corresponding E1s, 5 E2s, 9 E3s, 10 DUBs, 9 Ub-binding proteins and multiple proteasome subunits (Fig. 9B),. Although this list is small compared to all potential Ub pathway proteins (up to ~1,000) in the predicted proteome, it overlapped significantly with known Ub enzymes functioning in the neuronal system (e.g. APC, Mindbomb, TRIM, FAM, UCH-L1, and USP14, see the introduction), suggesting these detected proteins are highly active in the brain tissue. A number of proteins related to neurodegenerative diseases were also identified, such as APP, alpha-synuclein, UCH-L, USP14, and VCP/p9723. However, the role of most of the discovered Ub events is not known. Thus this proteomics analysis provides important targets for future investigation.

DISCUSSION Prior to the development of K-GG monoclonal antibodies, ubiquitome studies had been solely based on affinity purification of Ub-conjugates, leading to global identification of as many as 5756 putative Ub substrates in mammalian cells36. The validation of these substrates relies on individual immunoblotting, large-scale virtual western blotting48, identification of GG modification sites5., and quantitative comparison upon perturbation of Ub system6,32. The analysis of GG modification sites is, however, hampered by the “undersampling” issue of the LC-MS/MS system when K-GG peptides compete with much higher levels of non-GG peptides in the same sample for ionization and selection for MS/MS. The development of the K-GG monoclonal Abs largely alleviates this problem and permits selective enrichment of K-GG peptides37-39, 15 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

increasing the identified GG sites up to 19,000. In one single analysis with four rounds of immunoisolation, the Gygi group identified ~4000 GG peptides from a cell line treated with proteasome inhibitor38. Using similar reagents, procedures and instrument settings, we identified 932 GG peptides from the brain sample. The difference may be largely due to the ubiquitome abundance variation in a treated cell line versus the brain, as the bulk of GG peptides were isolated during the first round of our experiment. Indeed, previous reports indicated that fast growing cells have a much higher level of ubiquitination than the cells in the brain tissue41,54. Comparing the direct Ab enrichment with the SCX-Ab method, the latter method provides only ~2-fold increase in GG peptide identification. The effectiveness of SCX implementation appears to be lower than that for the analysis of total proteome or phosphoproteome. This may be also affected by the low abundance of ubiquitome and sample loss during fractionation. During the preparation of this manuscript, the Carr group also performed similar comparison and found 3-4 fold improvement with a minimal SCX separation (i.e. 4 fractions), consistent with our observation50. To fully realize the benefits of SCX chromatography, more starting materials and/or higher sensitive LC-MS/MS methods will be needed. In summary, we showed that the K-GG Ab enrichment method differentiated K-GG peptides from linear GG peptides or pseudo-GG peptides derived from iodoacetamide, and we addressed several important issues for GG peptide analysis, such as the reliability of the targetdecoy strategy, and the analysis of C-terminal K-GG peptides. The SCX-Ab method can separate peptides by their charge state and lead to improved GG peptide identification. More importantly, we showed that the current method is sensitive and able to detect these critical regulatory components during brain development and function, demonstrating the feasibility of this approach for the tissue analysis. Combining this method with quantitative approaches will allow the analysis of the ubiquitome dynamics in the brain.

ACKNOWLEDGEMENTS 16 ACS Paragon Plus Environment

Page 16 of 60

Page 17 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


This work was partially supported by National Institutes of Health grant RR025822 and American Cancer Society grant RSG-09-181, and ALSAC (American Lebanese Syrian Associated Charities). We thank Dr. John Rush for reagents, Drs. Woong Kim and Steven Gygi for discussion and data analysis.



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Figure Legends Fig. 1. Specificity of the K-GG antibody. (A). Lys residues modified by GG tag or IAA (two IAA molecules alkylating the amine group). (B). The detection of K48-GG (LIFAGK(GG)QLEDGR), K48 pseudo-GG, and another negative control peptide (K48 without GG, LIFAGKQLEDGR). These peptides were produced by either IAA reaction or chemical synthesis, and mixed as input for the Ab affinity purification. The equal percentage (3%) of the flowthrough and the eluent was run by LC-MS/MS for quantitative comparison. The signal of each peptide was extracted from ion current and plotted after normalization according to the strongest peak. Retention times are also indicated. (C). The analysis of M1-GG (GGMQIFVK) and other pseudo-GG in ubiquitin in the same samples. The K33 pseudo-GG peptide was eluted in two peaks that may be due to different configuration by proline isomerization.

Fig. 2. Filtering of false positive GG peptides by the target-decoy method. (A). Multiple steps to filter false positive GG matches during data processing. (B). The total and GG peptides matched to the target-decoy database before filtering. E. coli peptide mixture containing no GG peptides was used in the analysis. (C). The effect of mass accuracy cutoffs on the acceptance of various peptides. The LC-MS/MS systematic mass deviation was evaluated by standard deviation (SD) of empirical good peptide matches. The false discovery rate at 4 SD is 25.2%. (D). The peptides matched to the target-decoy database after mass accuracy filtering at 4 SD. (E). Distribution of XCorr and Cn values of either target or decoy GG peptides after mass accuracy filtering. (F). The peptides after final XCorr and Cn based filtering, resulting in ~1% peptide FDR.


Page 18 of 60

Page 19 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


(G). The LC-MS/MS runs of an E. coli sample and a rat K-GG fraction were merged into one raw dataset and filtered by mass accuracy. The distribution of target and decoy GG peptides was shown. (H). The accepted total and GG peptides in the merged dataset with ~1% peptide FDR.

Fig. 3. Strategies for GG peptide enrichment with or without SCX fractionation (A). The scheme of the strategies. (B). The distribution of possible GG peptides in SCX fractions based on solution charge states. Under low pH condition (pH =3), three residues (H. K and R) and N-terminal amine groups are positive charged, while phosphorylation introduces a negative charged group, and acetylation neutralizes the amine groups.

Fig. 4. Rat cortical GG peptides were analyzed by immunoaffinity purification with or without SCX fractionation. (A). The identified total and GG peptides by multiple cycle of Ab enrichment. (B). The identified total and GG peptides by SCX chromatography and Ab enrichment. The data was pooled for the final dataset. (C). A small portion of every SCX fraction (with shown elution profile) was analyzed to determine solution charge distribution, and the remaining sample was subjected to Ab pulldown and LC-MS/MS analysis.

Fig. 5. Identification of GG peptides with additional modifications. (A). An MS/MS scan assigned to an acetylated GG peptide. (B). The SCX fractions containing identified N-terminal acetylated GG peptides. (C). An MS/MS scan assigned to a phosphorylated GG peptide. (D) An MS/MS scan assigned to a deamidated GG peptide. 19 ACS Paragon Plus Environment


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Fig. 6. The evaluation of C-terminal modified GG peptides identified in the brain proteome. (A). The classification of these C-term GG peptides. (B). An MS/MS scan assigned to a GG peptide derived from the C-terminus of a protein. (C). The internal Lys residue distribution in identified C-term GG peptides. (D) The internal Lys residue distribution in the accepted GG peptide dataset (Table S1)

Fig. 7. The measurement of Ub, Nedd8 and ISG15 in metabolically labeled mouse brain. (A). Light recombinant proteins were mixed with monomeric (less than 12 KDa) or conjugated (>12 KDa) metabolically labeled mouse cerebral cortex (heavy Lys, +6.0201 Da). These mixed proteins were digested with trypsin and analyzed on LC-MS to quantitate Ub and Nedd8 levels. (B). The quantified protein level listed.

Fig. 8. The abundance of modified proteins in the Ub/Nedd8-modified proteome. (A). Distribution of GG tagged proteins based on total spectral counts. (B) The list of ubiquitinated proteins with spectral count of at least 100. (C) Relative level of polyUb linkages in the brain.

Fig. 9. Identified proteins involved in synaptic function or Ub/Nedd8 modifications. (A). Synaptic proteins classified by the location. (B) Ub/Nedd8 pathway proteins classified by the function.


Page 20 of 60

Page 21 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


REFERENCES: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20. 21. 22. 23. 24.

25. 26. 27. 28. 29. 30. 31. 32. 33. 34. 35.

Hershko, A.; Ciechanover, A. Annu. Rev. Biochem. 1998, 67, 425-479 Varshavsky, A. Trends Biochem. Sci. 2005, 30, 283-286 Ciechanover, A.; Ben-Saadon, R. Trends Cell. Biol. 2004, 14, 103-106 Kirisako, T.; Kamei, K.; Murata, S.; Kato, M.; Fukumoto, H.; Kanie, M.; Sano, S.; Tokunaga, F.; Tanaka, K.; Iwai, K. EMBO J. 2006, 25, 4877-4887 Peng, J.; Schwartz, D.; Elias, J. E.; Thoreen, C. C.; Cheng, D.; Marsischky, G.; Roelofs, J.; Finley, D.; Gygi, S. P. Nat. Biotechnol. 2003, 21, 921-926 Xu, P.; Duong, D. M.; Seyfried, N. T.; Cheng, D.; Xie, Y.; Robert, J.; Rush, J.; Hochstrasser, M.; Finley, D.; Peng, J. Cell 2009, 137, 133-145 Cadwell, K.; Coscoy, L. Science (New York, N.Y 2005, 309, 127-130 Shimizu, Y.; Okuda-Shimizu, Y.; Hendershot, L. M. Mol. Cell 2010, 40, 917-926 Wang, X.; Herr, R. A.; Hansen, T. H. Traffic 2012, 13, 19-24 Reyes-Turcu, F. E.; Ventii, K. H.; Wilkinson, K. D. Annu. Rev. Biochem. 2009, 78, 363397 Weake, V. M.; Workman, J. L. Mol. Cell 2008, 29, 653-663 Harper, J. W.; Elledge, S. J. Mol. Cell 2007, 28, 739-745 Mukhopadhyay, D.; Riezman, H. Science (New York, N.Y 2007, 315, 201-205 Kirkin, V.; McEwan, D. G.; Novak, I.; Dikic, I. Mol. Cell 2009, 34, 259-269 Jiang, X.; Chen, Z. J. Nat. Rev. Immunol. 2012, 12, 35-48 Semple, C. A. Genome Res. 2003, 13, 1389-1394 Li, W.; Bengtson, M. H.; Ulbrich, A.; Matsuda, A.; Reddy, V. A.; Orth, A.; Chanda, S. K.; Batalov, S.; Joazeiro, C. A. PLoS ONE 2008, 3, e1487 Hochstrasser, M. Nature 2009, 458, 422-429 Darwin, K. H. Nat. Rev. Microbiol. 2009, 7, 485-491 Hegde, A. N.; DiAntonio, A. Nat. Rev. Neurosci. 2002, 3, 854-861 Tai, H. C.; Schuman, E. M. Nat. Rev. Neurosci. 2008, 9, 826-838 Bingol, B.; Sheng, M. Neuron 2011, 69, 22-32 Mabb, A. M.; Ehlers, M. D. Annu. Rev. Cell Dev. Biol. 2010, 26, 179-210 Deng, H. X.; Chen, W.; Hong, S. T.; Boycott, K. M.; Gorrie, G. H.; Siddique, N.; Yang, Y.; Fecto, F.; Shi, Y.; Zhai, H.; Jiang, H.; Hirano, M.; Rampersaud, E.; Jansen, G. H.; Donkervoort, S.; Bigio, E. H.; Brooks, B. R.; Ajroud, K.; Sufit, R. L.; Haines, J. L.; Mugnaini, E.; Pericak-Vance, M. A.; Siddique, T. Nature 2011, 477, 211-215 Ciechanover, A.; Brundin, P. Neuron 2003, 40, 427-446 Aebersold, R.; Mann, M. Nature 2003, 422, 198-207 Peng, J.; Gygi, S. P. J. Mass Spectrom. 2001, 36, 1083-1091. Marotti, L. A., Jr.; Newitt, R.; Wang, Y.; Aebersold, R.; Dohlman, H. G. Biochemistry 2002, 41, 5067-5074 Kirkpatrick, D. S.; Denison, C.; Gygi, S. P. Nat. Cell Biol. 2005, 7, 750-757 Xu, P.; Peng, J. Biochimica et biophysica acta 2006, 1764, 1940-1947 Jeram, S. M.; Srikumar, T.; Pedrioli, P. G.; Raught, B. Proteomics 2009, 9, 922-934 Meierhofer, D.; Wang, X.; Huang, L.; Kaiser, P. J. Proteome Res. 2008, 7, 4566-4576 Franco, M.; Seyfried, N. T.; Brand, A. H.; Peng, J.; Mayor, U. Mol. Cell. Proteomics 2011, 10, M110 002188 Starita, L. M.; Lo, R. S.; Eng, J. K.; von Haller, P. D.; Fields, S. Proteomics 2012, 12, 236-240 Shi, Y.; Chan, D. W.; Jung, S. Y.; Malovannaya, A.; Wang, Y.; Qin, J. Mol. Cell. Proteomics 2011, 10, M110 002089



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

36. 37. 38. 39. 40. 41. 42. 43. 44. 45. 46. 47. 48. 49. 50. 51. 52. 53. 54.

Page 22 of 60

Danielsen, J. M.; Sylvestersen, K. B.; Bekker-Jensen, S.; Szklarczyk, D.; Poulsen, J. W.; Horn, H.; Jensen, L. J.; Mailand, N.; Nielsen, M. L. Mol. Cell. Proteomics 2011, 10, M110 003590 Xu, G.; Paige, J. S.; Jaffrey, S. R. Nat. Biotechnol. 2010, 28, 868-873 Kim, W.; Bennett, E. J.; Huttlin, E. L.; Guo, A.; Li, J.; Possemato, A.; Sowa, M. E.; Rad, R.; Rush, J.; Comb, M. J.; Harper, J. W.; Gygi, S. P. Mol. Cell 2011, 44, 325-340 Wagner, S. A.; Beli, P.; Weinert, B. T.; Nielsen, M. L.; Cox, J.; Mann, M.; Choudhary, C. Mol. Cell. Proteomics 2011, 10, M111 013284 Nielsen, M. L.; Vermeulen, M.; Bonaldi, T.; Cox, J.; Moroder, L.; Mann, M. Nat. Methods 2008, 5, 459-460 Dammer, E. B.; Na, C. H.; Xu, P.; Seyfried, N. T.; Duong, D. M.; Cheng, D.; Gearing, M.; Rees, H.; Lah, J. J.; Levey, A. I.; Rush, J.; Peng, J. J. Biol. Chem. 2011, 286, 1045710465 Peng, J.; Elias, J. E.; Thoreen, C. C.; Licklider, L. J.; Gygi, S. P. J. Proteome Res. 2003, 2, 43-50 Elias, J. E.; Gygi, S. P. Nat. Methods 2007, 4, 207-214 Kruger, M.; Moser, M.; Ussar, S.; Thievessen, I.; Luber, C. A.; Forner, F.; Schmidt, S.; Zanivan, S.; Fassler, R.; Mann, M. Cell 2008, 134, 353-364 Xu, P.; Duong, D. M.; Peng, J. J. Proteome Res. 2009, 8, 3944-3950 Shi, Y.; Xu, P.; Qin, J. Mol. Cell. Proteomics 2011, 10, R110.006882 Tasaki, T.; Sriram, S. M.; Park, K. S.; Kwon, Y. T. Annu. Rev. Biochem. 2012, 81, 261289 Seyfried, N. T.; Xu, P.; Duong, D. M.; Cheng, D.; Hanfelt, J.; Peng, J. Anal. Chem. 2008, 80, 4161-4169 Skaug, B.; Chen, Z. J. Cell 2010, 143, 187-190 Udeshi, N. D.; Mani, D. R.; Eisenhaure, T.; Mertins, P.; Jaffe, J. D.; Clauser, K. R.; Hacohen, N.; Carr, S. A. Mol. Cell. Proteomics 2012, 11, 148-159 Liu, H.; Sadygov, R. G.; Yates, J. R., 3rd. Anal. Chem. 2004, 76, 4193-4201 Lin, A.; Hou, Q.; Jarzylo, L.; Amato, S.; Gilbert, J.; Shang, F.; Man, H. Y. J. Neurochem. 2011, 119, 27-39 Fu, A. K.; Hung, K. W.; Fu, W. Y.; Shen, C.; Chen, Y.; Xia, J.; Lai, K. O.; Ip, N. Y. Nat. Neurosci. 2011, 14, 181-189 Kaiser, S. E.; Riley, B. E.; Shaler, T. A.; Trevino, R. S.; Becker, C. H.; Schulman, H.; Kopito, R. R. Nat. Methods 2011, 8, 691-696


Page 23 of 60

Graphic presentation:

Percentage of each charge state (%)

Absorbance at 215 nm (x103)

Rat Brain Ubiquitome Analysis 4 3 2 1 0 100 80

2+

3+

4+

5+

60 40 20 0 10

# of identified peptides

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


1,500

15

20

25 SCX fractions

30

35

40

1413

1298 942

1,000

855

total peptides GG peptides

841

721

622

500

365 45

585 399

330 175

61

570

139

184

281 158

171

0 5-15

16

17

18

19 20 SCX fractions

21


22

23-29 30-40


Fig. 1 A

B K48 (IAA)2 & K48-GG

GG peptides from Ub-conjugates Relative intensity

IAA modified pseudo GG peptides O NH2-C-CH2 O NH2-C-CH2

100%

100%

O O NH2-CH2-C-NH-CH2-C-NH-K

K48 peptide without GG

Flowthrough 3% 15%

0.02% N-K*

Elution 3%

26% 0.07%

6.0-7.5 min

4.2-5.7 min

C M1-GG 100%

K6 (IAA)2 100%

K11 (IAA)2 100%

K27 (IAA)2 100%

K33 (IAA)2 100%

K63 (IAA)2 100% Flowthrough 3%

Relative intensity

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

Page 24 of 60

Elution 3% 0.04% 5.0-6.5 min

0.04% 5.0-6.5 min

0.01%

0.03%

6.0-7.5 min

5.2-6.7 min

ACS Paragon Plus Environment

0.05% 4.0-5.5 min

0.05% 4.5-6.0 min

Page 25 of 60

Fig. 2

XCorr & Cn filtering

6,000

5613

4,000 1660

2,000 562

562

D 5,000 4,000

2,000 1,000 0

F

G Total peptides GG peptides

3

Target Decoy

2

1


GG peptide distribution 4,000

0

0 0

0.2

0.4 Cn

0.6

6

2 Target

~1% FDR 15

2,000 1,000

5

Target Decoy

Target Decoy (After mass filtering)

0.2 0.4 0.6 0.8


Cn

Rat total Rat GG E.coli total E.coli GG

417

400 309

300

1

248

200 ~1% FDR

100 0

(After two-step filtering)

216

0

Decoy 0 0

652 209

500

4

7

3,000

H

E. coli + Rat

3636

2,000

4515

4,000

3

GG peptide distribution

3,000

1,000

5,000

Mass accuracy filtering (±ppm)

(Before filtering)

E. coli sample

2

XCorr

E

* 1 4SD

0 Target Decoy

Final datasets

Target total Decoy total Target GG Decoy GG

3,000

0

Total peptides GG peptides

25.2% FDR

6,000


Mass accuracy filtering


All matched peptides

Charge state grouping

C

Total peptides GG peptides


B


A

XCorr

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48


0

3 1 0 0

Target

Decoy

(After two-step filtering)


Fig. 3 A

Ub

B

Ub Ub

K

Ub

K

Solution charge in SCX buffers: (X = any residues except H, K or R) (n = 0, 1, 2, …)

Rat brain lysate K

3+:

Common GG peptides:

Lys-C & trypsin digestion

+ GN-term-G

+

+ GG K

XN-term-Xn-K-Xn-K/R

Rat brain peptide mix 2+:

Immunoaffinity

GG K

Some protein C-terminal GG peptides:

Strong cation exchange chromatography

+ GN-term-G

+

Absorbance

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

Page 26 of 60

XN-term-Xn-K-Xn N-terminally blocked GG peptides:

+

Time

GN-term-G

Immunoaffinity Reverse phase LC-MS/MS

+ X(e.g. acetylation)-Xn-K-Xn-K/R GG K Singly phosphorylated GG peptides:

+ GN-term-G Reverse phase LC-MS/MS


+

-

+

XN-term-Xn-K-Xn-S/T/Y-Xn-K/R

Page 27 of 60

C total peptides GG peptides 2172 1923

915 99

1st


2,500 2,000 1,500 1,000 500 0

2nd

Immunoaffinity round

B

3 2 1 0 100 80

3129 2064

Merge

With SCX

932

1769

2+

3+

4+

5+

60 40 20 0 10

8156

7453

Without SCX

10,000 8,000 6,000 4,000 2,000 0

4

total peptides GG peptides # of identified peptides


A


Fig. 4


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48


1,500

15

20

25 SCX fractions

30

35

40

1413 1298 942

1,000

855


841

721

622

500

365

585 399

330 175

45

61

570

139

184

281 158

171

0 5-15

16

17


18

19 20 SCX fractions

21

22

23-29 30-40


b2 b3 b4 b5 b6 Acetyl-AS

Relative abundance

T E G A N N M P K Q V E V R y14 y13 y12 y11 y10 y9

100

G G

b8 b9

Fig. 5

B # of N-term acetylated GG peptides

A y8

y7 y6 y5

y4

y3

y2

y1

y7

50 b4

y3

y2

C

b5 y 4

y8 y5

y1 b b2 3

b6

200

600

400

b8

y9

y10

y12

y11

y 6 b9

30

28

25 20 15 10

7

5

2

0

y13

y14

5-15

800 1000 1200 1400 1600 MS/MS scan (m/z)

16 SCX fractions

D

G b2 G b3 b4 b5 b6 b7 b8 b10 b12 b14 y11

y9 y8 y7 y6 y5

17

G

P

b2 b3 b4

b5 G b6 b7 b8

Ndeamidated A I N M

AD K A A A S G P A S A S A P A A E I L L T PAR

y8 y7 y6 y5

y3

K y4

D V K y3

y2

y4-H3PO4

y6-H3PO4

y3

y7-H3PO4 y5-H3PO4 y5

50

b6 b3 b4 b5 b2

200

400

y6 b7

y13-H3PO4

y8-H3PO4 y9-H3PO4 y10-H3PO4 b8

y11 b14

y7 b10 y 8

b12 y9

600 800 1000 MS/MS scan (m/z)

1200

Relative abundance

y11-H3PO4

100 Relative abundance

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

Page 28 of 60

100

y6 y72+

50

y82+ y b5 4

y2 b2

200


b3

y3

b4

400

y5

b7 b6

600 800 MS/MS scan (m/z)

y 7 b8

1000

Page 29 of 60

Fig. 6 A

B 125

120

y1

100 Relative abundance

# of identified proteins

140

100 80 60

45 36

40 20

G G

b2 b3

AQ T M A N S G I K y8 y7

b2

y6 y5

y4 y3 y2 y1

50 b3

y2 y3

y4 y5

y8

y6

y7

3

0

100

C

50 45 40 35 30 25 20 15 10 5 0

With unmodified K

45

24

24

11

9

8 5

-1

-2

-3 -4 -5 -6 Internal Lys position

3

-7

200 300

400 500 600 700 800 MS/MS scan (m/z)

900

D # of identified GG peptides

Protein C- No internal Multiple term K GG tag # of identified GG peptides

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48


250 195

200 158

165 140

150

136

167

173

-7

-8

139

100 50 0

-8


-1

-2

-3 -4 -5 -6 Internal Lys position


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

Page 30 of 60

Fig. 7

A

Light: Purified recombinant proteins Heavy: Metabolically labeled mouse brain 250 100

B Measurement of Ub family proteins in rodent brain tissue

Conjugated form

50 Conjugated forms

Free form

20

10

Monomeric forms

Protein name

pmol/mg

Ubiquitin

122.6 ± 10.3

Nedd8

< 2.0

ISG15

< 2.0

Ubiquitin

111.6 ± 6.9

Nedd8

5.9 ± 0.4

ISG15

< 2.0

Peptides used in absolute quantification: Ub (TLSDYNIQK, TITLEVEPSDTIENVK, LIFAGK), Nedd8 (TAADYK, EIEIDIEPTDK, LIYSGK) and ISG15 (LTQTVAHLK).


Page 31 of 60

Fig. 8

# of identified proteins

A

600 500 400 300 200 100 0

C

539

154

119 73 18

17

1

Protein SC range

B # of identified SC

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48


800

684

600

538

400 200

282 172

149 10

0

1

K6 K11 K27 K29 K33 K48 K63 Different polyUb linkages

Highly abundant proteins in the brain ubiquitome Accession # Protein Name Total SC Ubiquitin pathway proteins P62982 Ubiquitin 1835 Q00981 Ubiquitin carboxyl‐terminal hydrolase L1 448 D3ZVQ0 Ubiquitin specific peptidase 5 125 Histones Q00715 Histone H2B 303 Q02874 Histone H2A 114 Chaperones P63018 Hsc70, heat shock cognate 71 kDa protein 160 Cytoskeleton components P60711 Actin, cytoplasmic 173 P68370 Tubulin, alpha chain 153 Membrane Proteins P11506 Plasma membrane calcium‐transporting ATPase 2 157 P06687 Sodium/potassium‐transporting ATPase subunit alpha‐3 133 P06686 Sodium/potassium‐transporting ATPase subunit alpha‐2 100 102 Q5PQL7 Integral membrane protein 2C Synapse regulators P47942 Dihydropyrimidinase‐related protein 2 111 P61265 Syntaxin‐1B 123 P11275 CaMKII subunit alpha 118 Others P13233 2',3'‐cyclic‐nucleotide 3'‐phosphodiesterase 391 P59215 Guanine nucleotide‐binding protein G(o) subunit alpha 174 P63102 14‐3‐3 protein zeta/delta, KCIP‐1 112



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

A

Identified synaptic proteins Accession# Protein Name Presynaptic O88778 Bassoon Q9QUL6 NSF, vesicle‐fusing ATPase P60881 SNAP25 P09951 Synapsin‐1 Q63537 Synapsin‐2 Q02563 Synaptic vesicle glycoprotein 2A Q63564 Synaptic vesicle glycoprotein 2B P21707 Synaptotagmin‐1 P29101 Synaptotagmin‐2 P40748 Synaptotagmin‐3 P47861 Synaptotagmin‐5 O08835 Synaptotagmin‐11 Q925B5 Synaptotagmin‐13 P61265 Syntaxin‐1B O70257 Syntaxin‐7 Q63666 Vesicle‐associated membrane protein 1 P63025 Vesicle‐associated membrane protein 3 Q9JHW5 Vesicle‐associated membrane protein 7 Q62634 Vesicular glutamate transporter 1 Q9JI12 Vesicular glutamate transporter 2 P37377 Synuclein, alpha Q63754 Synuclein, beta P08592 APP, amyloid precursor protein Q63374 Neurexin‐2‐alpha Postsynaptic P31016 PSD‐95, disks large homolog 4 Q62936 SAP‐102, disks large homolog 3 Q62696 SAP‐97, disks large homolog 1 P97836 DAP1, GKAP, disks large‐associated protein 1 P97837 DAP2, disks large‐associated protein 2 P0C6T3 Prr7, Proline‐rich protein 7 P70587 Densin‐180, leucine‐rich repeat‐containing protein 7 P35439 NMDA receptor subunit NR1 G3V746 NMDA receptor subunit NR2B P19492 AMPA receptor GluR3 P62813 GABA (A) receptor subunit alpha‐1 P23576 GABA (A) receptor subunit alpha‐2 O88871 GABA (B) receptor subunit 2 P14842 Serotonin receptor 2A P08482 Muscarinic acetylcholine receptor M1 Q62888 Neuroligin‐2 Q63053 Arc, activity‐regulated cytoskeleton‐associated protein D3ZUV2 E3 ligase mindbomb 1 P11275 CaMKII subunit alpha P15791 CaMKII subunit delta P11730 CaMKII subunit gamma

B Total SC 14 37 80 25 3 2 2 47 1 3 7 19 1 123 1 1 79 22 35 1 4 1 8 4 35 5 1 1 7 5 6 2 10 20 9 3 2 3 5 10 16 13 118 1 38

Identified Ub/Nedd8 pathway proteins Accession# Protein Name Ub/Nedd8 and E1/E2/E3 enzymes P62982 Ubiquitin Q71UE8 Nedd8 Q5U300 Ubiquitin‐activating enzyme E1 Q99MI7 NEDD8‐activating enzyme E1 D3ZDK2 Ubiquitin‐conjugating enzyme E2D1 B2RZA9 Ubiquitin‐conjugating enzyme E2L 3 Q9EQX9 Ubiquitin‐conjugating enzyme E2N F1M403 Ubiquitin‐conjugating enzyme E2O D3ZXV0 Ubiquitin‐conjugating enzyme E2QL1 B1WBY1 Cullin 1 B5DF89 Cullin 3 Q9JJ31 Cullin 5 D3ZUB7 E3 ligase APC subunit 4 D4ACN3 E3 ligase HERC2 D4AD30 E3 ligase itchy D3ZUV2 E3 ligase mindbomb 1 D3ZQG6 E3 ligase TRIM2 Q66H79 E3 ligase TRIM32 Deubiquitinating enzymes Q00981 Ubiquitin carboxyl‐terminal hydrolase L1 B2GUZ1 Ubiquitin carboxyl‐terminal hydrolase 4 D3ZVQ0 Ubiquitin specific peptidase 5 D3ZYT1 Ubiquitin specific peptidase 14 D4ACD3 Ubiquitin specific peptidase 25 F1LSM0 Ubiquitin specific peptidase 24 F1LYJ4 Ubiquitin specific peptidase 34 D3ZC84 Ubiquitin specific peptidase 9, X‐linked B2RYG6 Ubiquitin thioesterase OTUB1 Q32Q05 Ubiquitin thioesterase OTU1, Yod1 Ub receptors (Ub binding domains) D4AD39 RAD23A Q4KMA2 RAD23B A0JPP7 DDI1, DNA‐damage inducible 1 Q9JJP9 Ubiquilin 1 P46462 VCP/p97 O88339 Epsin 1 P0C0A2 Vacuolar protein sorting 36 B5DF55 Stam1 (SH3 and VHS domains) Q501R9 Nbr1, neighbor of Brca1 gene 1 Ub‐proteosomal system (selected) P17220 Proteasome 26S subunit, alpha type 2 G3V7Q6 Proteasome 26S subunit, beta type Q63347 Proteasome 26S subunit, ATPase, rpt1 P62193 Proteasome 26S subunit, ATPase, rpt2 Q63569 Proteasome 26S subunit, ATPase, rpt5 Q9JMB5 Proteasome 26S subunit, rpn13


Page 32 of 60

Fig. 9 Total SC 1835 97 7 6 4 3 17 3 9 2 5 13 1 1 32 13 1 3 448 10 125 2 3 27 4 3 5 1 3 61 1 22 41 2 3 25 1 22 9 7 3 10 11

Page 33 of 60

Journal of Proteome Research Table S1: The list of GG peptides identified in rat brain by mass spectrometry

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

The list is sorted by protein names and then by peptide spectral counts."#": GG modification; "]": acetylation; "$": phosphorylation;"%": oxidation;"@": deamidation. Total: 1786 GG sites on 2064 peptides in 921 proteins Accession # Protein Names GG Peptides XCorr deltaCn Charge m/z Peptide Spectral Counts Protein Spectral Counts P35213 14-3-3 protein beta/alpha K.SELVQK#AK.L 2.595 0.178 3 468.5883 8 18 P35213 14-3-3 protein beta/alpha R.YLSEVASGDNK#QTTVSNSQQAYQEAFEISK.K 2.595 0.178 3 468.5883 4 18 P35213 14-3-3 protein beta/alpha R.YLSEVASGDNK#QTTVSNSQQAYQEAFEISKK.E 2.595 0.178 3 468.5883 3 18 P35213 14-3-3 protein beta/alpha K.QTTVSNSQQAYQEAFEISK#K.E 2.595 0.178 3 468.5883 2 18 14-3-3 protein beta/alpha R.VISSIEQK#TER.N 2.595 0.178 3 468.5883 1 18 P35213 P62260 14-3-3 protein epsilon K.HLIPAANTGESK#VFYYK.M 2.459 0.318 3 479.5837 14 25 P62260 14-3-3 protein epsilon R.IISSIEQK#EENK.G 2.459 0.318 3 479.5837 4 25 P62260 14-3-3 protein epsilon R.YLAEFATGNDRK#EAAENSLVAYK.A 2.459 0.318 3 479.5837 3 25 P62260 14-3-3 protein epsilon K.MK#GDYHR.Y 2.459 0.318 3 479.5837 2 25 P62260 14-3-3 protein epsilon R.K#EAAENSLVAYK.A 2.459 0.318 3 479.5837 1 25 P62260 14-3-3 protein epsilon R.DNLTLWTSDMQGDGEEQNK#EALQDVEDENQ. 2.459 0.318 3 479.5837 1 25 P68511 14-3-3 protein eta K.K#NSVVEASEAAYK.E 2.116 0.334 3 436.8974 4 8 P68511 14-3-3 protein eta R.VISSIEQK#TMADGNEK.K 2.116 0.334 3 436.8974 3 8 P68511 14-3-3 protein eta R.YLAEVASGEK#K.N 2.116 0.334 3 436.8974 1 8 P61983 14-3-3 protein gamma R.VISSIEQK#TSADGNEK.K 2.525 0.152 4 619.5505 11 33 P61983 14-3-3 protein gamma R.EQLVQK#AR.L 2.525 0.152 4 619.5505 9 33 14-3-3 protein gamma R.YLAEVATGEK#R.A 2.525 0.152 4 619.5505 9 33 P61983 P61983 14-3-3 protein gamma K.RATVVESSEK#AYSEAHEISK.E 2.525 0.152 4 619.5505 3 33 P61983 14-3-3 protein gamma K.AYSEAHEISK#EHMQPTHPIR.L 2.525 0.152 4 619.5505 1 33 P68255 14-3-3 protein theta R.K#QTIENSQGAYQEAFDISK.K 2.416 0.223 2 522.806 4 12 P68255 14-3-3 protein theta K.QTIENSQGAYQEAFDISK#K.E 2.416 0.223 2 522.806 3 12 P68255 14-3-3 protein theta R.VISSIEQK#TDTSDK.K 2.416 0.223 2 522.806 3 12 P68255 14-3-3 protein theta K.TELIQK#AK.L 2.416 0.223 2 522.806 2 12 P63102 14-3-3 protein zeta/delta, KCIP-1 K.K#GIVDQSQQAYQEAFEISK.K 1.952 0.359 3 456.2339 24 112 1.952 0.359 3 456.2339 16 112 P63102 14-3-3 protein zeta/delta, KCIP-1 R.YLAEVAAGDDK#K.G P63102 14-3-3 protein zeta/delta, KCIP-1 K.K#GIVDQSQQAYQEAFEISKK.E 1.952 0.359 3 456.2339 16 112 P63102 14-3-3 protein zeta/delta, KCIP-1 R.VFYLK#MK.G 1.952 0.359 3 456.2339 13 112 P63102 14-3-3 protein zeta/delta, KCIP-1 R.VVSSIEQK#TEGAEK.K 1.952 0.359 3 456.2339 11 112 P63102 14-3-3 protein zeta/delta, KCIP-1 R.VFYLK#M%K.G 1.952 0.359 3 456.2339 8 112 1.952 0.359 3 456.2339 7 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.AK#LAEQAER.Y P63102 14-3-3 protein zeta/delta, KCIP-1 K.NELVQK#AK.L 1.952 0.359 3 456.2339 6 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.K#EMQPTHPIR.L 1.952 0.359 3 456.2339 3 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.MK#GDYYR.Y 1.952 0.359 3 456.2339 2 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.N@ELVQK#AK.L 1.952 0.359 3 456.2339 2 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.GIVDQSQQAYQEAFEISK#K.E 1.952 0.359 3 456.2339 2 112 P63102 14-3-3 protein zeta/delta, KCIP-1 K.K#EM%QPTHPIR.L 1.952 0.359 3 456.2339 1 112 P63102 14-3-3 protein zeta/delta, KCIP-1 -.M]DK#NELVQK.A 1.952 0.359 3 456.2339 1 112 P10687 1-phosphatidylinositol-4,5-bisphosphate phosphodiesK.QLAALTLEDEEEVK#K.E 2.013 0.348 3 499.9417 3 4 P10687 1-phosphatidylinositol-4,5-bisphosphate phosphodiesK.DK#QQQQLLNLR.Q 2.013 0.348 3 499.9417 1 4 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.M%VSADAYK#IIPGSR.A 1.996 0.461 2 574.3196 209 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.MVSADAYK#IIPGSR.A 1.996 0.461 2 574.3196 95 391 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.AGQVFLEELGNHK#AFK.K 1.996 0.461 2 574.3196 19 391 P13233 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.AGQVFLEELGNHK#AFKK.E 1.996 0.461 2 574.3196 16 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.EK#LDLVSYFGK.R 1.996 0.461 2 574.3196 12 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase R.ADFSEEYK#R.L 1.996 0.461 2 574.3196 10 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase R.KAGQVFLEELGNHK#AFK.K 1.996 0.461 2 574.3196 6 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.NQWQLSLDDLK#K.L 1.996 0.461 2 574.3196 6 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.LYSLGK#GR.W 1.996 0.461 2 574.3196 5 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.K#LKPGLEK.D 1.996 0.461 2 574.3196 4 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.EK#NQWQLSLDDLK.K 1.996 0.461 2 574.3196 3 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.EK#NQWQLSLDDLKK.L 1.996 0.461 2 574.3196 3 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase K.GK#PVPVHGSR.K 1.996 0.461 2 574.3196 1 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase R.LIVEK#YHNGTK.M 1.996 0.461 2 574.3196 1 391 P13233 2',3'-cyclic-nucleotide 3'-phosphodiesterase R.HFISGDEPK#EK.L 1.996 0.461 2 574.3196 1 391 Q6AXQ5 2',5'-phosphodiesterase 12 K.LALNPLAQEK#VLQR.S 2.904 0.656 3 569.667 1 1 O88761 26S proteasome non-ATPase regulatory subunit 1 K.DSDSMETEEK#TAGAVAGK.T 2.545 0.248 3 570.96 2 3 O88761 26S proteasome non-ATPase regulatory subunit 1 K.TAGAVAGK#TPDASPEPK.D 2.545 0.248 3 570.96 1 3 P51639 3-hydroxy-3-methylglutaryl-coenzyme A reductase R.VLEEEENK#PNPVTQR.V 2.516 0.242 3 632.6542 1 1 P63326 40S ribosomal protein S10 R.SAVPPGADK#K.A 2.698 0.304 3 413.8976 24 26 P63326 40S ribosomal protein S10 R.RSAVPPGADK#K.A 2.698 0.304 3 413.8976 1 26 P63326 40S ribosomal protein S10 K.K#AEAGAGSATEFQFR.G 2.698 0.304 3 413.8976 1 26 P27952 40S ribosomal protein S2 K.SPYQEFTDHLVK#THTR.V 2.268 0.488 3 438.2501 15 26 P27952 40S ribosomal protein S2 K.AEDK#EWIPVTK.L 2.268 0.488 3 438.2501 9 26 P27952 40S ribosomal protein S2 K.EWIPVTK#LGR.L 2.268 0.488 3 438.2501 2 26 P60868 40S ribosomal protein S20 K.DTGK#TPVEPEVAIHR. 1.594 0.438 2 461.7388 8 12 P60868 40S ribosomal protein S20 -.A]FK#DTGK.T 1.594 0.438 2 461.7388 4 12 P05765 40S ribosomal protein S21 K.ADGIVSK#NF.2.539 0.619 2 532.7719 4 4 P62982 40S ribosomal protein S27a K.VDENGK#ISR.L 2.074 0.381 2 566.2904 14 14 P62909 40S ribosomal protein S3 K.KPLPDHVSIVEPK#DEILPTTPISEQK.G 4.328 0.283 4 756.9113 20 20 P62243 40S ribosomal protein S8 K.GAK#LTPEEEEILNK.K 4.193 0.248 3 562.2963 6 6 P38983 40S ribosomal protein SA R.AVLK#FAAATGATPIAGR.F 3.964 0.708 3 576.9947 7 7 Q794F9 4F2 cell-surface antigen heavy chain K.IK#VAEDEAEAGVK.F 3.993 0.552 3 919.4258 15 42 Q794F9 4F2 cell-surface antigen heavy chain K.FTGLSK#EELLK.V 3.993 0.552 3 919.4258 10 42 Q794F9 4F2 cell-surface antigen heavy chain K.DVELNELEPEK#QPMNAADGAAAGEK.N 3.993 0.552 3 919.4258 10 42 Q794F9 4F2 cell-surface antigen heavy chain K.QPMNAADGAAAGEK#NGLVK. 3.993 0.552 3 919.4258 4 42 Q794F9 4F2 cell-surface antigen heavy chain K.VAEDEAEAGVK#FTGLSK.E 3.993 0.552 3 919.4258 2 42 Q794F9 4F2 cell-surface antigen heavy chain K.DVELNELEPEK#QPM%NAADGAAAGEK.N 3.993 0.552 3 919.4258 1 42 P14842 Serotonin receptor 2A R.AK#LASFSFLPQSSLSSEK.L 2.283 0.497 3 681.0244 3 3 P35427 60S ribosomal protein L13a K.VLDGIPPPYDK#K.K 2.534 0.272 3 485.9331 1 2 P35427 60S ribosomal protein L13a K.YQAVTATLEEK#RK.E 2.534 0.272 3 485.9331 1 2 P12001 60S ribosomal protein L18 K.ILTFDQLALESPK#GR.G 3.811 0.582 2 915.9812 3 4 P12001 60S ribosomal protein L18 R.ENK#TAVVVGTITDDVR. 3.811 0.582 2 915.9812 1 4 K.K#LLADQAEAR.R 2.257 0.278 2 587.8373 2 5 P84100 60S ribosomal protein L19 P84100 60S ribosomal protein L19 K.KEEIIK#TLSK.E 2.257 0.278 2 587.8373 2 5 P84100 60S ribosomal protein L19 K.EEIIK#TLSK.E 2.257 0.278 2 587.8373 1 5 K.K#LYDIDVAK.V 2.48 0.401 2 589.8239 1 1 P62752 60S ribosomal protein L23a P83732 60S ribosomal protein L24 R.AITGASLADIMAK#R.N 2.834 0.574 3 511.2801 1 1 R.YSVDIPLDK#TVVNK.D 2.845 0.176 3 568.976 2 2 P61354 60S ribosomal protein L27 P18445 60S ribosomal protein L27a K.QPVIVK#AK.V 1.736 0.222 2 498.8148 1 1 P21531 60S ribosomal protein L3 K.LIK#NNASTDYDLSDK.S 2.28 0.215 3 470.6101 9 12 P21531 60S ribosomal protein L3 K.IYK#IGQGYLIK.D 2.28 0.215 3 470.6101 3 12 P62890 60S ribosomal protein L30 K.SGK#YVLGYK.Q 2.443 0.335 3 376.8734 9 9 60S ribosomal protein L4 K.KLEAAAAALAAK#SEK. 3.552 0.088 3 529.3013 2 2 P50878 60S ribosomal protein L6 K.VLATVTK#TVGGDK.N 3.481 0.224 2 701.8984 2 2 P21533 60S ribosomal protein L9 K.TILSNQTVDIPENVDITLK#GR.T 1.829 0.71 3 814.1058 2 2 P17077 P47860 6-phosphofructokinase type C K.ISAK#AMEWISAK.L 2.422 0.314 2 540.2948 7 15 P47860 6-phosphofructokinase type C -.S]DQDSSTSSTSFPK#YLEHLSGDGK.A 2.422 0.314 2 540.2948 4 15 K.RLNIIIVSEGAIDTQNK#PITSEK.I 2.422 0.314 2 540.2948 2 15 P47860 6-phosphofructokinase type C P47860 6-phosphofructokinase type C R.NFGTK#ISAK.A 2.422 0.314 2 540.2948 1 15 P47860 6-phosphofructokinase type C R.SFEGNLNTYK#R.L 2.422 0.314 2 540.2948 1 15 P30835 6-phosphofructokinase, liver type -.A]TVDLEK#LR.M 2.551 0.239 2 600.8358 1 1 Abhydrolase domain-containing protein FAM108A R.ELDTIEVFVTK#SAR.A 1.782 0.472 2 510.2802 15 19 Q5XIJ5 Q5XIJ5 Abhydrolase domain-containing protein FAM108A R.VAFPDTK#K.T 1.782 0.472 2 510.2802 4 19 Q4FZU0 Acid phosphatase 6, lysophosphatidic K.K#AAISQPGILEDLEK.V 2.498 0.321 3 575.9833 6 6 Acidic leucine-rich nuclear phosphoprotein 32 family K.DLSTVEALQNLK#NLK.S 2.679 0.076 3 600.667 2 2 Q5XIE0 P60711 Actin, cytoplasmic K.EITALAPSTM%K#IK.I 2.448 0.26 3 560.2886 58 173 P60711 Actin, cytoplasmic K.EITALAPSTMK#IK.I 2.448 0.26 3 560.2886 26 173 P60711 Actin, cytoplasmic R.MQK#EITALAPSTMK.I 2.448 0.26 3 560.2886 26 173 Actin, cytoplasmic R.VAPEEHPVLLTEAPLNPK#ANR.E 2.448 0.26 3 560.2886 21 173 P60711 P60711 Actin, cytoplasmic R.M%QK#EITALAPSTMK.I 2.448 0.26 3 560.2886 12 173 Actin, cytoplasmic R.K#DLYANTVLSGGTTM%YPGIADR.M 2.448 0.26 3 560.2886 7 173 P60711 P60711 Actin, cytoplasmic K.IK#IIAPPER.K 2.448 0.26 3 560.2886 6 173 Actin, cytoplasmic K.DSYVGDEAQSK#R.G 2.448 0.26 3 560.2886 5 173 P60711 P60711 Actin, cytoplasmic K.IK#IIAPPERK.Y 2.448 0.26 3 560.2886 3 173 P60711 Actin, cytoplasmic R.HQGVM%VGM%GQK#DSYVGDEAQSK.R 2.448 0.26 3 560.2886 3 173 Actin, cytoplasmic R.HQGVM%VGMGQK#DSYVGDEAQSK.R 2.448 0.26 3 560.2886 3 173 P60711 P60711 Actin, cytoplasmic R.K#DLYANTVLSGGTTMYPGIADR.M 2.448 0.26 3 560.2886 2 173 P60711 Actin, cytoplasmic R.MQK#EITALAPSTM%K.I 2.448 0.26 3 560.2886 1 173 Actin-related protein 2 K.ILLTEPPMNPTK#NR.E 2.765 0.608 3 585.3122 5 7 Q5M7U6 Q5M7U6 Actin-related protein 2 K.ILLTEPPM%NPTK#NR.E 2.765 0.608 3 585.3122 2 7 Q99PD4 Actin-related protein 40942 complex subunit 1A K.EVDEK#PASTPWGSK.M 2.462 0.173 2 822.8978 6 6 Activin receptor type-1 K.IDNSLDK#LK.T 2.493 0.227 2 580.3192 1 1 P80201 P07308 Acyl-CoA desaturase 1 K.GGK#LDMSDLK.A 1.775 0.548 2 618.3307 2 3 P07308 Acyl-CoA desaturase 1 K.AEK#LVMFQR.R 1.775 0.548 2 618.3307 1 3 P11030 Acyl-CoA-binding protein K.TYVEK#VEELK.K 2.411 0.105 3 737.7285 7 10 P11030 Acyl-CoA-binding protein K.TYVEK#VEELKK.K 2.411 0.105 3 737.7285 2 10 Acyl-CoA-binding protein K.QATVGDVNTDRPGLLDLK#GK.A 2.411 0.105 3 737.7285 1 10 P11030 D4A6X4 Acylphosphatase R.GTVQGQLQGPVSK#VR.F 2.804 0.675 3 556.6452 1 1 P69682 Adaptin ear-binding coat-associated protein 1 K.IAYIK#LEDK.V 2.435 0.196 3 402.8957 5 5 Adaptor protein, phosphotyrosine interaction, PH domK.EIIEVQK#DPEALAR.L 2.58 0.355 2 717.8823 2 4 B4F779 B4F779 Adaptor protein, phosphotyrosine interaction, PH domK.NSDTGYVK#IVPK.A 2.58 0.355 2 717.8823 1 4


GG sites K11 K140 K140 K159 K70 K118 K69 K142 K125 K142 K244 K143 K69 K142 K69 K10 K142 K152 K162 K139 K157 K68 K9 K139 K138 K139 K120 K68 K120 K11 K9 K158 K122 K9 K157 K158 K3 K839 K1011 K87 K87 K216 K216 K234 K101 K216 K174 K376 K175 K163 K163 K401 K73 K232 K426 K302 K310 K248 K138 K138 K139 K275 K58 K65 K8 K4 K81 K113 K214 K128 K89 K42 K59 K21 K35 K53 K21 K277 K114 K159 K132 K78 K153 K186 K186 K115 K93 K93 K125 K300 K286 K26 K364 K104 K21 K692 K15 K281 K688 K395 K8 K92 K226 K207 K113 K326 K326 K315 K113 K315 K291 K328 K61 K328 K50 K50 K291 K315 K118 K118 K179 K504 K198 K208 K77 K77 K51 K58 K59 K618 K426


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

B4F779 Adaptor protein, phosphotyrosine interaction, PH domK.K#QESFYFSQNIK.N P10760 Adenosylhomocysteinase K.K#LDEAVAEAHLGK.L NP_001100450.1 adenylate cyclase 9 K.VGQSIMHGK#DLEVEK.A NP_001100450.1 adenylate cyclase 9 K.DLEVEK#ALK.E NP_001100450.1 adenylate cyclase 9 K.VGQSIM%HGK#DLEVEK.A P26769 Adenylate cyclase type 2 K.K#EREEIETMENLNR.V P26769 Adenylate cyclase type 2 K.FK#KEREEIETMENLNR.V P21932 Adenylate cyclase type 3 K.IEVHDQK#ER.V Q04400 Adenylate cyclase type 5 K.DK#NAQESANPEDEVDEFLGR.A D3ZH63 Adenylate kinase 7 (Predicted) K.VPK#ENAFLTK.D P52481 Adenylyl cyclase-associated protein 2 R.SALFAQLNQGEAITK#GLR.H D4A631 ADP-ribosylation factor guanine nucleotide-exchangeR.LDSTQAGEFLGDNDK#FNK.E O08697 ADP-ribosylation factor-like protein 2 K.LNIWDVGGQK#SLR.S Q66HA6 ADP-ribosylation factor-like protein 8B R.DLPNALDEK#QLIEK.M Q66HA6 ADP-ribosylation factor-like protein 8B R.KVTK#GNVTIK#IWDIGGQPR.F Q5XI97 Alanyl-tRNA editing protein Aarsd1 R.VAEVLEGK#GAGK.K Q5XI42 Aldehyde dehydrogenase family 3 member B1 K.ATEK#ILAEVLPR.Y Q9Z1P2 Alpha-actinin-1 R.QK#ASIHEAWTDGK.E Alpha-actinin-1 R.HRPELIDYGK#LR.K Q9Z1P2 Q9Z1P2 Alpha-actinin-1 R.DAK#GISQEQMNEFR.A P04764 Alpha-enolase K.YGK#DATNVGDEGGFAPNILENK.E P04764 Alpha-enolase R.IEEELGSK#AK.F Alpha-enolase K.GVSK#AVEHINK.T P04764 P04764 Alpha-enolase K.K#LNVVEQEK.I P04764 Alpha-enolase K.RIAK#AAGEK.S P23565 Alpha-internexin R.AQYESLAAK#NLQSAEEWYK.S P23565 Alpha-internexin R.TNEK#EQLQGLNDR.F P21396 Amine oxidase K.IHFK#PELPPER.N P63003 Amino-terminal enhancer of spli R.AK#QVTAPELNSIIR.Q P63003 Amino-terminal enhancer of spli K.LASEK#SEMQR.H O08838 Amphiphysin R.DLATYK#GLFPENFTR.R A1L134 Ancient ubiquitous protein 1 R.VQQLVAK#ELGQIGTR.L P23347 Anion exchange protein 2 R.LLPPGAGLEPK#SAQDK.A P23348 Anion exchange protein 3 R.EQTK#VEMTTR.G P23348 Anion exchange protein 3 R.EREQTK#VEM%TTR.G P23348 Anion exchange protein 3 R.EREQTK#VEMTTR.G P23348 Anion exchange protein 3 R.GGYVAPGK#ELSLEMGGSEATSEDDPLQR.T P0C6S7 Ankyrin repeat and sterile alpha motif domain-containK.TLANLPWIVEPGQEAK#R.G P0C6S7 Ankyrin repeat and sterile alpha motif domain-containK.FIDAANK#NIIAEHEIR.N Q5U313 Ankyrin repeat domain 13a R.LTLDLMK#PK.S Q5U313 Ankyrin repeat domain 13a R.LTLDLM%K#PK.S Ankyrin repeat domain 13a R.TDK#AEVVNGYEAK.V Q5U313 Q76K24 Ankyrin repeat domain-containing protein 46 R.LLESLEEQEVK#GFNR.G Annexin A5 K.GAGTDEK#VLTEIIASR.T P14668 P48037 Annexin A6 R.AINEAYK#EDYHK.S Annexin A6 -.A]K#IAQGAMYR.G P48037 P48037 Annexin A6 R.TNEQIHQLVAAYK#DAYER.D P18484 AP-2 complex subunit alpha-2 K.QLSNPQQEVQNIFK#AK.H P62944 AP-2 complex subunit beta K.K#GEIFELK.A P62944 AP-2 complex subunit beta -.T]DSK#YFTTNK.K P84092 AP-2 complex subunit mu K.IVIEK#QGK.G P84092 AP-2 complex subunit mu K.ESQISAEIELLPTNDK#K.K P84092 AP-2 complex subunit mu R.LSK#FDSER.S P84092 AP-2 complex subunit mu K.GTADETSK#SGK.Q P02650 Apolipoprotein E R.LAK#EVQAAQAR.L P02650 Apolipoprotein E R.SK#MEEQTQQIR.L P08592 APP, amyloid precursor protein R.HLSK#MQQNGYENPTYK.F P08592 APP, amyloid precursor protein R.HLSK#M%QQNGYENPTYK.F P47863 Aquaporin-4 K.EAFSK#AAQQTK.G P47863 Aquaporin-4 K.AAQQTK#GSYMEVEDNR.S P47863 Aquaporin-4 K.GK#DSSGEVLSSV.P47863 Aquaporin-4 K.AAQQTK#GSYM%EVEDNR.S Q63053 Arc, activity-regulated cytoskeleton-associated protei K.K#WWEFK.Q Q63053 Arc, activity-regulated cytoskeleton-associated protei K.K#EFLQYSEGTLSR.E Q63053 Arc, activity-regulated cytoskeleton-associated protei R.GGPAAK#PNVILQIGK.C P40329 Arginyl-tRNA synthetase, cytoplasmic K.SDGGYTYDTSDLAAIK#QR.L Q5XID7 Armadillo repeat-containing X-linked protein 3 K.EK#ALIVLNNLSVNAENQR.R B2RYJ7 ARP1 actin-related protein 1 homolog B (Yeast) K.DQLQTFSEEHPVLLTEAPLNPSK#NR.E B4F7F3 Arvcf protein K.NLDGEK#STTR.D P13221 Aspartate aminotransferase, cytoplasmic R.VLSQMEK#IVR.I P13221 Aspartate aminotransferase, cytoplasmic R.IVATTLSNPELFK#EWK.G P13221 Aspartate aminotransferase, cytoplasmic R.VLSQM%EK#IVR.I NP_001164074.1 astrotactin 1 precursor K.SGMDLTPGSDNAK#LSLMNK.Y NP_001164074.1 astrotactin 1 precursor K.SGM%DLTPGSDNAK#LSLM%NK.Y Q9ER24 Ataxin-10 K.IVGDEQLTK#DDISIFLR.H B2GUV5 ATPase, H transporting, lysosomal V1 subunit G1 -.A]SQSQGIQQLLQAEK#R.A Q9ESR9 ATP-binding cassette sub-family A member 2 R.K#DALPGAEGLTAVESQAGNLAR.C Q9ESR9 ATP-binding cassette sub-family A member 2 K.VSEEDQSLENSEADVK#ESR.K Q9ESR9 ATP-binding cassette sub-family A member 2 R.LPVSTK#PVEDDVDVASER.Q P16970 ATP-binding cassette sub-family D member 3 K.MTIMEQK#YEGEYR.F P16970 ATP-binding cassette sub-family D member 3 K.MTIM%EQK#YEGEYR.F G3V642 ATP-binding cassette, sub-family G (WHITE), membeK.TLLK#GISGK.F P49655 ATP-sensitive inward rectifier potassium channel 10 -.T]SVAK#VYYSQTTQTESRPLVAPGIR.R P49655 ATP-sensitive inward rectifier potassium channel 10 K.LLQTHQTK#EGENIR.L P49655 ATP-sensitive inward rectifier potassium channel 10 R.YGDPEK#LK.L ATP-sensitive inward rectifier potassium channel 10 K.LK#LEESLREQAEK.E P49655 P49655 ATP-sensitive inward rectifier potassium channel 10 K.LEESLREQAEK#EGSALSVR.I K.SGEAEEPVPK#PYSQDLSR.S O88778 Bassoon O88778 Bassoon K.QGMEQK#ISK.F Q6AY58 B-cell receptor-associated protein 31 K.AENEALAMQK#QSEGLTK.E Bcl-2-like protein 1 R.EVIPMAAVK#QALR.E P53563 O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/ K.NK#DYMSIIR.M Q6AY24 BMSC-UbP, ubiquitin-like 7 K.SWPEPDQKPEPVDK#VAALR.E Q78EA7 Bone morphogenetic protein receptor type-1A K.TLAK#MVESQDVKI.Brain acid soluble protein 1 K.KAEGAGTEEEGTQK#ESEPQAAADATEVK.E F1LNN9 F1LNN9 Brain acid soluble protein 1 K.ESEPQAAADATEVK#ESAEEKPK.D F1LNN9 Brain acid soluble protein 1 K.AEGAGTEEEGTQK#ESEPQAAADATEVK.E F1LNN9 Brain acid soluble protein 1 K.DAADGEAK#AEEK.E Brain acid soluble protein 1 K.ESAEEK#PK.D F1LNN9 F1LNN9 Brain acid soluble protein 1 K.K#TEAPAAGPEAK.S F1LNN9 Brain acid soluble protein 1 K.EEAPK#AEPEK.S F1LNN9 Brain acid soluble protein 1 K.AAAK#EEAPK.A Brain acid soluble protein 1 K.APAPAAPAAEPQAEAPVASSEQSVAVK#E. F1LNN9 F1LNN9 Brain acid soluble protein 1 K.SDAAPAASDSK#PSSAEPAPSSK.E F1LNN9 Brain acid soluble protein 1 K.AEPEK#SEGAAEEQPEPAPAPEQEAAAPGPAAG F1LNN9 Brain acid soluble protein 1 K.K#AEGAGTEEEGTQK.E Brain acid soluble protein 1 K.ESAEEKPK#DAADGEAK.A F1LNN9 O88881 Brain-enriched guanylate kinase-associated protein K.LEK#LETEFDSTR.H D4A831 Brain-specific angiogenesis inhibitor 3 (Predicted R.TAVK#NFMASELDDNAGLSR.S D4A831 Brain-specific angiogenesis inhibitor 3 (Predicted R.ISLNDEEEEK#GTNPEGLSYSTLPGNVISK.V P54690 Branched-chain-amino-acid aminotransferase, cytosoR.AK#DLIITK.A P54690 Branched-chain-amino-acid aminotransferase, cytosoK.DLIITK#ADVLK.K P54690 Branched-chain-amino-acid aminotransferase, cytosoR.IMAK#LTDIQYGR.I R.QAK#QLLIDPEDDVRDNILK.Y Q9Z1Y3 Cadherin-2 P63100 Calcineurin subunit B type 1 K.M%M%VGNNLK#DTQLQQIVDK.T K.MM%VGNNLK#DTQLQQIVDK.T P63100 Calcineurin subunit B type 1 P63100 Calcineurin subunit B type 1 K.MMVGNNLK#DTQLQQIVDK.T P63100 Calcineurin subunit B type 1 K.M%MVGNNLK#DTQLQQIVDK.T P63100 Calcineurin subunit B type 1 K.EFIEGVSQFSVK#GDK.E O70150 Calcium/calmodulin-dependent protein kinase type 1BR.GK#EALVENEIAVLR.R Q62976 Calcium-activated potassium channel subunit alpha- R.SFIK#IEEDTWQK.Y Q64566 Calcium-transporting ATPase type 2C member 1 K.TQK#NTTSTPSSFLEV.Q64566 Calcium-transporting ATPase type 2C member 1 K.AK#GIVIGTGENSEFGEVFK.M R.FQK#IPNVENETMIPVLTSK.R Q64566 Calcium-transporting ATPase type 2C member 1 Q64566 Calcium-transporting ATPase type 2C member 1 R.DLYQQEK#AQMGSAGLR.V P62161 Calmodulin K.DGDGTITTK#ELGTVMR.S K.DGDGTITTK#ELGTVM%R.S P62161 Calmodulin P62161 Calmodulin R.VFDK#DGNGYISAAELR.H P62161 Calmodulin K.EAFSLFDK#DGDGTITTK.E Q63092 CaM kinase-like vesicle-associated protein R.ITAEEAISHEWISGNAASDK#NIK.D Q63092 CaM kinase-like vesicle-associated protein K.K#NYNQPSEVTDRYDLGQVVK.T CaMKII subunit alpha K.DLINK#MLTINPSK.R P11275 P11275 CaMKII subunit alpha K.VLAGQEYAAK#IINTK.K P11275 CaMKII subunit alpha R.DLKPENLLLASK#LK.G CaMKII subunit alpha K.DLINK#M%LTINPSK.R P11275

2.58 3.348 2.388 2.388 2.388 3.281 3.281 2.76 3.055 1.776 3.171 2.425 2.661 2.126 2.126 2.583 2.666 2.212 2.212 2.212 2.117 2.117 2.117 2.117 2.117 2.694 2.694 2.17 2.794 2.794 3.172 2.84 2.317 2.192 2.192 2.192 2.192 3.31 3.31 1.979 1.979 1.979 3.288 3.235 2.318 2.318 2.318 2.462 2.423 2.423 1.886 1.886 1.886 1.886 2.893 2.893 3.41 3.41 3.678 3.678 3.678 3.678 2.972 2.972 2.972 3.803 4.043 3.339 1.914 2.375 2.375 2.375 2.851 2.851 2.476 2.953 4.04 4.04 4.04 2.26 2.26 1.69 3.687 3.687 3.687 3.687 3.687 1.964 1.964 2.394 3.738 2.532 3.15 2.749 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 1.664 2.992 2.701 2.701 3.624 3.624 3.624 2.721 3.46 3.46 3.46 3.46 3.46 2.615 2.825 3.771 3.771 3.771 3.771 2.033 2.033 2.033 2.033 2.943 2.943 2.363 2.363 2.363 2.363

0.355 0.455 0.264 0.264 0.264 0.41 0.41 0.256 0.35 0.204 0.252 0.103 0.527 0.051 0.051 0.141 0.458 0.153 0.153 0.153 0.286 0.286 0.286 0.286 0.286 0.402 0.402 0.532 0.529 0.529 0.48 0.239 0.257 0.18 0.18 0.18 0.18 0.542 0.542 0.116 0.116 0.116 0.452 0.637 0.466 0.466 0.466 0.074 0.309 0.309 0.295 0.295 0.295 0.295 0.349 0.349 0.706 0.706 0.757 0.757 0.757 0.757 0.201 0.201 0.201 0.558 0.728 0.24 0.352 0.322 0.322 0.322 0.296 0.296 0.288 0.36 0.44 0.44 0.44 0.135 0.135 0.214 0.441 0.441 0.441 0.441 0.441 0.137 0.137 0.133 0.705 0.473 0.434 0.349 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.259 0.395 0.683 0.683 0.469 0.469 0.469 0.077 0.125 0.125 0.125 0.125 0.125 0.25 0.601 0.37 0.37 0.37 0.37 0.455 0.455 0.455 0.455 0.397 0.397 0.252 0.252 0.252 0.252

2 3 2 2 2 3 3 3 3 2 3 3 3 3 3 3 3 4 4 4 2 2 2 2 2 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 3 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 4 2 2 2 2 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 2 2 2 2 2 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3

717.8823 498.9349 579.8212 579.8212 579.8212 635.6422 635.6422 423.2169 793.0226 630.851 677.7055 704.9995 533.9588 780.1055 780.1055 424.5702 485.2845 403.4742 403.4742 403.4742 529.3087 529.3087 529.3087 529.3087 529.3087 553.6076 553.6076 492.9359 646.8173 646.8173 629.3185 585.3356 578.9823 546.6022 546.6022 546.6022 546.6022 656.6822 656.6822 396.8937 396.8937 396.8937 635.6628 591.9823 632.8274 632.8274 632.8274 662.6838 539.3002 539.3002 548.275 548.275 548.275 548.275 497.9121 497.9121 689.989 689.989 652.9609 652.9609 652.9609 652.9609 557.9492 557.9492 557.9492 692.3273 713.7215 745.1313 617.8044 666.8696 666.8696 666.8696 709.0003 709.0003 692.7045 647.6748 690.6841 690.6841 690.6841 603.2711 603.2711 515.8161 843.9545 843.9545 843.9545 843.9545 843.9545 388.2025 388.2025 654.6568 513.9596 418.5479 759.3931 525.9515 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 516.2534 527.9301 1078.8647 1078.8647 508.2721 508.2721 508.2721 779.7517 892.4463 892.4463 892.4463 892.4463 892.4463 552.3089 819.4122 636.9789 636.9789 636.9789 636.9789 653.6465 653.6465 653.6465 653.6465 823.079 823.079 397.217 397.217 397.217 397.217


Page 34 of 60 1 2 3 2 2 1 1 1 2 1 1 4 2 17 1 2 2 5 2 2 4 3 2 2 1 2 1 2 7 3 13 14 1 6 1 1 1 4 1 2 1 1 3 12 2 1 1 1 2 2 4 3 1 1 4 2 7 1 9 6 5 2 12 2 2 1 6 2 1 18 6 1 4 1 1 2 4 3 2 2 1 3 6 3 2 1 1 13 1 1 2 2 1 2 4 4 4 2 1 1 1 1 1 1 1 1 1 2 2 1 5 2 1 2 3 3 3 2 1 1 4 9 5 2 1 21 9 8 4 4 1 23 21 20 15

4 2 7 7 7 2 2 1 2 1 1 4 2 18 18 2 2 9 9 9 12 12 12 12 12 3 3 2 10 10 13 14 1 9 9 9 9 5 5 4 4 4 3 12 4 4 4 1 4 4 9 9 9 9 6 6 8 8 22 22 22 22 16 16 16 1 6 2 1 25 25 25 5 5 1 2 9 9 9 3 3 3 13 13 13 13 13 14 14 1 2 2 1 2 23 23 23 23 23 23 23 23 23 23 23 23 23 2 3 3 8 8 8 2 12 12 12 12 12 1 4 17 17 17 17 42 42 42 42 5 5 118 118 118 118

K407 K389 K321 K327 K321 K839 K838 K878 K705 K256 K276 K754 K71 K141 K62,K68 K376 K148 K402 K195 K741 K202 K420 K64 K81 K330 K278 K95 K284 K112 K54 K671 K250 K650 K642 K642 K642 K656 K1248 K1122 K217 K217 K257 K137 K106 K478 K3 K135 K855 K12 K5 K224 K378 K256 K235 K105 K252 K751 K751 K268 K274 K313 K274 K252 K269 K24 K393 K182 K119 K878 K290 K318 K290 K294 K294 K262 K16 K1340 K1336 K2026 K260 K260 K102 K6 K224 K354 K356 K367 K664 K3363 K213 K87 K195 K106 K523 K38 K52 K38 K68 K58 K146 K85 K80 K220 K168 K90 K25 K60 K46 K1385 K1228 K53 K59 K393 K756 K125 K125 K125 K125 K85 K54 K584 K907 K229 K8 K514 K31 K31 K95 K22 K294 K12 K250 K42 K146 K250

Page 35 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


P11275 CaMKII subunit alpha R.ITAAEALK#HPWISHR.S P11275 CaMKII subunit alpha K.MLTINPSK#R.I P11275 CaMKII subunit alpha K.ESSESTNTTIEDEDTK#VR.K P11275 CaMKII subunit alpha K.DLINK#MLTINPSKR.I P11275 CaMKII subunit alpha K.NDGVK#ESSESTNTTIEDEDTK.V P11275 CaMKII subunit alpha R.LLK#HPNIVR.L P11275 CaMKII subunit alpha K.M%LTINPSK#R.I P11275 CaMKII subunit alpha K.KNDGVK#ESSESTNTTIEDEDTK.V P15791 CaMKII subunit delta K.IPTGQEYAAK#IINTK.K P11730 CaMKII subunit gamma R.DLK#PENLLLASK.S P11730 CaMKII subunit gamma R.DHQK#LER.E P11730 CaMKII subunit gamma K.TSTQEYAAK#IINTK.K P27791 cAMP-dependent protein kinase catalytic subunit alphK.K#GSEQESVK.E P12369 cAMP-dependent protein kinase type II-beta regulato R.GQYFGELALVTNK#PR.A P12369 cAMP-dependent protein kinase type II-beta regulato K.LVK#EGEHVIDQGDDGDNFYVIDR.G Q5M9G3 Caprin-1 K.YQEVTNNLEFAK#ELQR.S P97633 Casein kinase I isoform alpha -.A]SSSGSK#AEFIVGGK.Y Q62761 Casein kinase I isoform gamma-1 R.GSLPWQGLK#ADTLK.E K.SPEEM%YIQQK#VR.V Q4KM58 Catenin, beta-interacting protein 1 P41350 Caveolin-1 -.S]GGK#YVDSEGHLYTVPIR.E P41350 Caveolin-1 R.EQGNIYK#PNNK.A Q5M7A7 CB1 cannabinoid receptor-interacting protein 1 R.TIK#LLTGSSYK.V R.VVYTGIYDTEGVAPTK#SGER.Q Q5M7A7 CB1 cannabinoid receptor-interacting protein 1 Q1WIM2 Cell adhesion molecule 2 K.GAEDAPDADTAIINAEGSQVNAEEK#K.E Q1WIM2 Cell adhesion molecule 2 R.HK#GTYLTNEAK.G Q1WIM2 Cell adhesion molecule 2 K.GTYLTNEAK#GAEDAPDADTAIINAEGSQVNAEEK Q1WIM3 Cell adhesion molecule 3 K.GSDDAPDADTAIINAEGGQSGGDDK#K.E Q1WIM3 Cell adhesion molecule 3 K.GSDDAPDADTAIINAEGGQSGGDDK#KEYFI.Q6AY41 Cell cycle control protein 50A K.DEVDGGPTGPPGGAAK#TR.R Q5FVI4 Cell cycle exit and neuronal differentiation protein 1 K.DAQAEK#QEQPAAPGPATTK.K Q5FVI4 Cell cycle exit and neuronal differentiation protein 1 K.QEQPAAPGPATTK#K.T Q5FVI4 Cell cycle exit and neuronal differentiation protein 1 K.VPQATAEAK#ATPAADGK.A Q8CFN2 Cell division control protein 42 homolog K.QK#PITPETAEK.L Q8CFN2 Cell division control protein 42 homolog K.QKPITPETAEK#LAR.D Q9EPF2 Cell surface glycoprotein MUC18 K.SDK#LPEEMALLQGSNGDK.R Q9EPF2 Cell surface glycoprotein MUC18 R.K#SEFVVEVK.S D4ACB8 Chaperonin subunit 8 (Theta) (Predicted), isoform CRR.LEK#LFVTNDAATILR.E D4ACB8 Chaperonin subunit 8 (Theta) (Predicted), isoform CRK.ETEGDVTSVK#DAK.I D4ACB8 Chaperonin subunit 8 (Theta) (Predicted), isoform CR-.A]LHVPK#APGFAQMLK.D Q9Z0W7 Chloride intracellular channel protein 4 K.LHIVK#VVAK.K Q9EPT8 Chloride intracellular channel protein 5 K.LHVVK#IVAK.K K.TQELRDPVLSGAIATK#MAR.F O54783 Choline/ethanolamine kinase Q9QZC4 Choline-phosphate cytidylyltransferase B K.EFVNRVEEK#SHDLIQK.W R.LK#EEESFNIQNSMSPK.L Q9ERQ6 Chondroitin sulfate proteoglycan 5 Q9ERQ6 Chondroitin sulfate proteoglycan 5 R.LK#EEESFNIQNSM%SPK.L K.IQEALK#SR.L Q9ERQ6 Chondroitin sulfate proteoglycan 5 Q63116 C-kit receptor tyrosine kinase K.QVVQLIEK#QISDSSK.H Q05140 Clathrin coat assembly protein AP180 R.YLNEK#AFSYR.Q P11442 Clathrin heavy chain 1 R.AVNYFSK#VK.Q P11442 Clathrin heavy chain 1 R.VNIPK#VLR.A P11442 Clathrin heavy chain 1 K.QLLEK#WLK.E P11442 Clathrin heavy chain 1 K.AGK#TLQIFNIEMK.S P11442 Clathrin heavy chain 1 K.EYLTK#VDK.L P11442 Clathrin heavy chain 1 K.VAANAPK#GILR.T P11442 Clathrin heavy chain 1 K.TGQIK#EVER.I P11442 Clathrin heavy chain 1 K.VIALK#AGK.T P11442 Clathrin heavy chain 1 K.AGK#TLQIFNIEM%K.S P11442 Clathrin heavy chain 1 K.LHIIEVGTPPTGNQPFPK#K.A P11442 Clathrin heavy chain 1 K.TLQIFNIEMK#SK.M P08081 Clathrin light chain A R.SVLISLK#QAPLVH.G3V674 Claudin domain containing 1, isoform CRA_ K.EYTLMK#AYR.V Q99P82 Claudin-11 R.FYYSSGSSSPTHAK#SAHV.Q99JD4 CLIP-associating protein 2 K.VK#VAILK.Y NP_001156745.1 c-Maf-inducing protein R.QIEETK#PLLGSDVSAPEGTK.V O35142 Coatomer subunit beta R.DFSMADK#VLPTIPK.E P45592 Cofilin-1 R.YALYDATYETK#ESK.K P45592 Cofilin-1 K.K#NIILEEGK.E Q810U0 Coiled-coil domain-containing protein 50 K.QLQEEDLK#AQAQLQK.R Q810U0 Coiled-coil domain-containing protein 50 R.K#LQEEELLATHMDIR.A Q66H73 Coiled-coil domain-containing protein 82 K.NSK#TQVPEQK.S Q5BJT7 Coiled-coil domain-containing protein 93 R.DQLNDQYLELLEK#QR.L Q9Z1T4 Connector enhancer of kinase suppressor of ras 2 R.SPTSSVATPSSTISTPTK#R.D Q9Z1T4 Connector enhancer of kinase suppressor of ras 2 K.VLDNPDLTSK#EFQQWK.Q P61203 COP9 signalosome complex subunit 2 R.IDQVNQLLELDHQK#R.G Q68FW9 COP9 signalosome complex subunit 3 R.LK#AM%DQEITVNPQFVQK.S Q68FW9 COP9 signalosome complex subunit 3 R.LK#AMDQEITVNPQFVQK.S D4A303 Core-binding factor, runt domain, alpha subunit 2; tra K.AAAMPDSPAEVK#TQPR.S P07335 Creatine kinase B-type K.LPHLGK#HEK.F P07335 Creatine kinase B-type K.FSEVLK#R.L P07335 Creatine kinase B-type R.VISMQK#GGNMK.E P25809 Creatine kinase U-type, mitochondria R.VVVDALSGLK#GDLAGR.Y B2GUU9 Cryptochrome 2 (Photolyase-like) R.YIYEPWNAPESVQK#AAK.C Q9EQH5 C-terminal-binding protein 2 R.GGLVDEK#ALAQALK.E Q792H5 CUGBP Elav-like family member 2 R.K#AALEAQNALHNIK.T Q792H5 CUGBP Elav-like family member 2 K.VFIDK#QTNLSK.C R.VDGEK#DTYSYLA.B1WBY1 Cullin 1 B1WBY1 Cullin 1 R.FINNNAVTK#MAQSSSK.S Cullin 3 K.STEEPIVK#VVER.E B5DF89 Q9JJ31 Cullin 5 R.TQEAIIQIMK#MR.K Q9JJ31 Cullin 5 R.TQEAIIQIMK#M%R.K R.TQEAIIQIM%K#MR.K Q9JJ31 Cullin 5 P30348 C-X-C motif chemokine 2 R.IVQK#ILNK.G Q03114 Cyclin-dependent kinase 5 R.N@GELK#LADFGLAR.A G3V6A1 Cysteine-rich hydrophobic domain 2 (Predicted R.SIEK#LLEWENNR.L R.RSIEK#LLEWENNR.L G3V6A1 Cysteine-rich hydrophobic domain 2 (Predicted Q63270 Cytoplasmic aconitate hydratase K.IETVNK#SWNALAAPSEK.L P38650 Cytoplasmic dynein 1 heavy chain 1 R.DLPPVSGSIIWAK#QIDR.Q P38650 Cytoplasmic dynein 1 heavy chain 1 K.SLLQALNEVK#GR.I Q63100 Cytoplasmic dynein 1 intermediate chain 1 K.LGVSK#VTQVDFLPR.E Q9JJ79 Cytoplasmic dynein 2 heavy chain 1 K.FELMMESHQLMIK#DQIEVMK.G O08651 D-3-phosphoglycerate dehydrogenase R.SATK#VTADVINAAEK.L O08651 D-3-phosphoglycerate dehydrogenase K.K#FMGTELNGK.T DAP1, GKAP, disks large-associated protein 1 R.EVYQK#ASVNMDQAVVK.S P97836 P97837 DAP2, disks large-associated protein 2 K.AVLVSK#AEELLK.S P97837 DAP2, disks large-associated protein 2 R.SIDK#AVLVSK.A D3ZRV0 DCN1, defective in cullin neddylation 1, domain contaK.AQIPK#MEQELK.E DCN1, defective in cullin neddylation 1, domain contaK.MEQELK#EPGR.F D3ZRV0 D3ZRV0 DCN1, defective in cullin neddylation 1, domain contaK.AQIPK#M%EQELK.E D3ZRV0 DCN1, defective in cullin neddylation 1, domain contaK.K#LEQLYNR.Y A0JPP7 DDI1, DNA-damage inducible 1 R.WAGVAK#GVGTQRIMGR.V Q5RJY4 Dehydrogenase/reductase SDR family member 7B R.NVK#ALEEFTR.E R.VPK#DEQGSAADSEDSPTIEAVR.L P06214 Delta-aminolevulinic acid dehydratase P70587 Densin-180, leucine-rich repeat-containing protein 7 R.VENANPTANTEQTVK#EK.F Densin-180, leucine-rich repeat-containing protein 7 K.ALIPLQTEAHPETK#QR.V P70587 Q62950 Dihydropyrimidinase-related protein 1 K.IVFEDGNISVSK#GMGR.F K.IVFEDGNISVSK#GM%GR.F Q62950 Dihydropyrimidinase-related protein 1 Q62950 Dihydropyrimidinase-related protein 1 K.AVGK#DNFTLIPEGVNGIEER.M Q62950 Dihydropyrimidinase-related protein 1 K.TLTAK#SHK.S Q62950 Dihydropyrimidinase-related protein 1 R.SK#VFGLHSVSR.G Q62950 Dihydropyrimidinase-related protein 1 R.K#PFPEHLYQR.V K.K#SIPHITSDR.L Q62950 Dihydropyrimidinase-related protein 1 Q62950 Dihydropyrimidinase-related protein 1 R.GMYDGPVYEVPATPK#HAAPAPSAK.S Q62950 Dihydropyrimidinase-related protein 1 R.GM%YDGPVYEVPATPK#HAAPAPSAK.S K.QIGENLIVPGGVK#TIEANGR.M Q62950 Dihydropyrimidinase-related protein 1 Q62950 Dihydropyrimidinase-related protein 1 K.SSPSK#HQPPPIR.N Q62950 Dihydropyrimidinase-related protein 1 K.HAAPAPSAK#SSPSK.H R.K#PFPDFVYK.R P47942 Dihydropyrimidinase-related protein 2 P47942 Dihydropyrimidinase-related protein 2 K.TSPAK#QQAPPVR.N P47942 Dihydropyrimidinase-related protein 2 K.TVTPASSAK#TSPAK.Q P47942 Dihydropyrimidinase-related protein 2 K.AVGK#DNFTLIPEGTNGTEER.M P47942 Dihydropyrimidinase-related protein 2 R.MSVIWDK#AVVTGK.M K.QIGENLIVPGGVK#TIEAHSR.M P47942 Dihydropyrimidinase-related protein 2 P47942 Dihydropyrimidinase-related protein 2 R.M%SVIWDK#AVVTGK.M P47942 Dihydropyrimidinase-related protein 2 R.K#PFPDFVYKR.I K.AIGK#DNFTAIPEGTNGVEER.M Q62952 Dihydropyrimidinase-related protein 3

2.363 2.363 2.363 2.363 2.363 2.363 2.363 2.363 3.02 1.975 1.975 1.975 2.229 5.206 5.206 3.256 3.112 2.838 2.76 1.803 1.803 1.823 1.823 2.304 2.304 2.304 3.686 3.686 2.917 2.259 2.259 2.259 2.304 2.304 2.083 2.083 2.628 2.628 2.628 1.946 2.952 4.294 2.792 2.411 2.411 2.411 2.749 2.02 1.827 1.827 1.827 1.827 1.827 1.827 1.827 1.827 1.827 1.827 1.827 3.21 1.843 4.415 1.696 3.15 2.79 2.123 2.123 3.374 3.374 1.602 2.783 3.027 3.027 3.339 3.127 3.127 2.306 1.916 1.916 1.916 2.222 3.215 2.928 2.155 2.155 2.183 2.183 2.56 1.86 1.86 1.86 1.846 3.362 3.068 3.068 3.022 2.647 2.647 2.646 2.584 2.091 2.091 2.976 3.012 3.012 1.845 1.845 1.845 1.845 1.757 2.326 4.591 4.28 4.28 2.857 2.857 2.857 2.857 2.857 2.857 2.857 2.857 2.857 2.857 2.857 2.857 3.131 3.131 3.131 3.131 3.131 3.131 3.131 3.131 2.023

0.252 0.252 0.252 0.252 0.252 0.252 0.252 0.252 0.216 0.345 0.345 0.345 0.361 0.795 0.795 0.509 0.556 0.227 0.296 0.269 0.269 0.218 0.218 0.366 0.366 0.366 0.404 0.404 0.359 0.654 0.654 0.654 0.53 0.53 0.186 0.186 0.182 0.182 0.182 0.231 0.326 0.701 0.071 0.196 0.196 0.196 0.147 0.238 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.569 0.546 0.656 0.133 0.341 0.335 0.196 0.196 0.278 0.278 0.07 0.14 0.447 0.447 0.224 0.729 0.729 0.131 0.325 0.325 0.325 0.662 0.065 0.368 0.465 0.465 0.565 0.565 0.242 0.145 0.145 0.145 0.163 0.394 0.562 0.562 0.373 0.138 0.138 0.528 0.032 0.039 0.039 0.334 0.355 0.355 0.419 0.419 0.419 0.419 0.134 0.49 0.569 0.026 0.026 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.496 0.378 0.378 0.378 0.378 0.378 0.378 0.378 0.378 0.218

3 3 3 3 3 3 3 3 3 2 2 2 2 3 3 3 2 3 3 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 2 2 3 3 3 2 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 3 2 2 2 3 3 2 2 3 3 2 3 3 3 4 3 3 3 2 2 2 3 3 3 3 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 4 2 2 3 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 3

397.217 397.217 397.217 397.217 397.217 397.217 397.217 397.217 587.6572 520.2677 520.2677 520.2677 553.2776 916.4349 916.4349 699.353 790.9003 543.2995 546.6028 709.8536 709.8536 662.8776 662.8776 688.3525 688.3525 688.3525 1057.4716 1057.4716 599.2906 684.6721 684.6721 684.6721 452.5773 452.5773 589.8241 589.8241 588.6591 588.6591 588.6591 560.8635 374.2449 724.3908 695.6942 353.5372 353.5372 353.5372 605.9994 468.9023 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 555.2947 506.9708 644.8226 1013.9657 442.7994 738.3812 559.2953 579.3298 579.3298 628.6652 628.6652 636.8298 673.6756 688.0129 688.0129 491.514 707.0328 707.0328 594.9656 496.7801 496.7801 496.7801 561.9825 703.3531 509.6224 469.5931 469.5931 737.8381 737.8381 500.6065 531.2809 531.2809 531.2809 357.2306 506.9391 600.9808 600.9808 658.0106 481.2756 481.2756 558.3149 649.3193 619.8148 619.8148 641.6598 587.3445 587.3445 722.8761 722.8761 722.8761 722.8761 900.9835 440.9018 805.7135 662.9917 662.9917 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 482.2589 782.4134 782.4134 782.4134 782.4134 782.4134 782.4134 782.4134 782.4134 417.8925


15 7 5 4 4 2 1 1 1 36 1 1 1 21 2 3 1 2 1 4 1 1 1 4 1 1 3 1 7 1 1 1 2 2 2 1 13 2 1 1 6 1 2 11 8 2 1 1 8 4 2 2 1 1 1 1 1 1 1 2 1 27 1 1 3 8 1 2 2 1 2 9 3 1 1 1 1 2 1 1 2 1 1 4 1 1 1 5 7 4 2 1 3 10 2 2 6 1 3 1 11 1 1 6 1 3 3 1 1 1 1 14 3 3 19 12 8 6 6 5 4 4 3 2 1 1 44 19 17 15 9 3 2 2 8

118 118 118 118 118 118 118 118 1 38 38 38 1 23 23 3 1 2 1 5 5 2 2 6 6 6 4 4 7 3 3 3 4 4 3 3 16 16 16 1 6 1 2 21 21 21 1 1 23 23 23 23 23 23 23 23 23 23 23 2 1 27 1 1 3 9 9 4 4 1 2 12 12 1 2 2 1 4 4 4 2 1 1 5 5 2 2 5 13 13 13 1 3 12 12 2 7 7 3 1 12 12 1 7 7 8 8 8 8 1 1 14 6 6 71 71 71 71 71 71 71 71 71 71 71 71 111 111 111 111 111 111 111 111 12

K267 K258 K344 K250 K328 K68 K258 K328 K43 K138 K57 K43 K9 K357 K174 K108 K8 K255 K19 K5 K26 K39 K98 K430 K396 K405 K391 K391 K24 K48 K61 K25 K135 K144 K618 K607 K62 K235 K7 K199 K196 K170 K270 K536 K536 K532 K927 K134 K1441 K1347 K450 K86 K1609 K389 K742 K83 K86 K245 K96 K242 K248 K203 K785 K19 K608 K92 K45 K68 K181 K14 K599 K342 K982 K415 K391 K391 K43 K304 K313 K242 K200 K474 K279 K94 K458 K769 K410 K262 K724 K724 K724 K92 K141 K117 K117 K621 K650 K3755 K150 K1030 K58 K137 K300 K709 K703 K148 K154 K148 K69 K297 K87 K87 K615 K423 K463 K463 K345 K423 K487 K472 K7 K511 K511 K56 K525 K520 K472 K525 K520 K345 K368 K56 K368 K472 K345


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q62952 Dihydropyrimidinase-related protein 3 K.QEVQNLSK#EK.G Q62952 Dihydropyrimidinase-related protein 3 R.K#MADLHAVPR.G Q62951 Dihydropyrimidinase-related protein 4 (Fragment R.GLYDGPVHEVM%LPAK#PGSGTQAR.A Q62951 Dihydropyrimidinase-related protein 4 (Fragment R.GLYDGPVHEVMLPAK#PGSGTQAR.A Q62951 Dihydropyrimidinase-related protein 4 (Fragment R.K#TFPDFVYK.R Q62951 Dihydropyrimidinase-related protein 4 (Fragment K.AVGK#DNFTLIPEGINGIEER.M Q9JHU0 Dihydropyrimidinase-related protein 5 R.TPYLGDVAVVVNPGK#K.E Q9JHU0 Dihydropyrimidinase-related protein 5 K.K#EMGTPLADTPTRPVTR.H Q63622 Disks large homolog 2 K.AVEALK#EAGSIVR.L Q63622 Disks large homolog 2 K.IIDGGAAQK#DGR.L Q63622 Disks large homolog 2 K.GPK#GLGFSIAGGVGNQHIPGDNSIYVTK.I Q63622 Disks large homolog 2 R.FEAK#IHDLR.E Q63622 Disks large homolog 2 K.FNAK#PGVIDSK.G Q63622 Disks large homolog 2 R.VNEVDVSEVSHSK#AVEALK.E Q63622 Disks large homolog 2 K.GDIPGLGDDGYGTK#TLR.G F1M680 DNA damage-binding protein 1 K.MQEVVANLQYDDGSGMK#R.E F1M680 DNA damage-binding protein 1 K.MQEVVANLQYDDGSGM%K#R.E F1M680 DNA damage-binding protein 1 K.M%QEVVANLQYDDGSGM%K#R.E K.M%QEVVANLQYDDGSGMK#R.E F1M680 DNA damage-binding protein 1 F1M680 DNA damage-binding protein 1 R.IVVFQYSDGK#LQTVAEK.E F1M680 DNA damage-binding protein 1 K.LQTVAEK#EVK.G O35824 DnaJ homolog subfamily A member 2 K.EISFAYEVLSNPEK#R.E R.EIYDQFGEEGLK#GGAGGTDGQGGTFR.Y NP_001013094.1 dnaJ homolog subfamily B member 4 P60905 DnaJ homolog subfamily C member 5 K.LALK#YHPDKNPDNPEAADK.F P60905 DnaJ homolog subfamily C member 5 K.FK#EINNAHAILTDATKR.N P60905 DnaJ homolog subfamily C member 5 K.FK#EINNAHAILTDATK.R P60905 DnaJ homolog subfamily C member 5 K.EINNAHAILTDATK#R.N P60905 DnaJ homolog subfamily C member 5 K.LALK#YHPDK.N P60905 DnaJ homolog subfamily C member 5 K.NPDNPEAADK#FK.E Q6XUX2 Dual serine/threonine and tyrosine protein kinase K.VAQEAIDSLSASK#LAK.S P36506 Dual specificity mitogen-activated protein kinase kinaR.DVK#PSNILVNSR.G B4F7B7 Dual specificity phosphatase-like 15 (Predicted), isofoR.ISVSDTPEVPIK#K.H P28023 Dynactin subunit 1 R.K#TSQLLEK.L Q6AYH5 Dynactin subunit 2 -.A]DPK#YADLPGIAR.N P21575 Dynamin-1 R.EISYAIK#NIHGIR.T P21575 Dynamin-1 R.VTGTNK#GISPVPINLR.V O35303 Dynamin-1-like protein K.VPVGDQPK#DIELQIR.E P63170 Dynein light chain 1, cytoplasmic K.YNIEK#DIAAHIK.K P63170 Dynein light chain 1, cytoplasmic K.YNIEK#DIAAHIKK.E P62628 Dynein light chain roadblock-type 1 -.A]EVEETLK#R.L D3ZUB7 E3 ligase APC subunit 4 K.K#LGQSIESSYSSIQK.L E3 ligase HERC2 R.TPLDK#DLINTGIYESSGK.Q D4ACN3 D4AD30 E3 ligase itchy K.EFDPLGPLPPGWEK#R.T E3 ligase itchy R.SQGQLNEK#PLPEGWEMR.F D4AD30 D4AD30 E3 ligase itchy R.VSTNGSEDPEVAASGENK#R.A E3 ligase itchy R.SQGQLNEK#PLPEGWEM%R.F D4AD30 D3ZUV2 E3 ligase mindbomb 1 K.K#LFETQESGDLNEELVK.A D3ZUV2 E3 ligase mindbomb 1 K.SSEEPSDDISSGNIPVLQK#DK.D D3ZUV2 E3 ligase mindbomb 1 K.WGK#QDGGEGHVGTVR.S D3ZUV2 E3 ligase mindbomb 1 K.LLLK#QNVDVEAEDK.D D3ZQG6 E3 ligase TRIM2 R.NK#GEFTNLQGVAASTSGK. Q66H79 E3 ligase TRIM32 R.K#FFTGSLAEVEK.S Q5XIQ4 E3 ubiquitin-protein ligase MGRN1 R.YK#DDTDSPTEDGEKPR.V P36407 E3 ubiquitin-protein ligase TRIM23 -.A]ALAVNK#PGAGVDSGR.Q Q2TL32 E3 ubiquitin-protein ligase UBR4 K.MAAETDPHK#SSEITK.N Q4FZY0 EF-hand domain-containing protein D2 R.K#AAAGELQEDSGLHVLAR.L Q8R3Z7 EH-domain containing 4 K.SISIIDSPGILSGEK#QR.I Q8CH84 ELAV-like protein 2 K.FANNPSQK#TNQAILSQLYQSPNR.R O09032 ELAV-like protein 4 K.FANNPSQK#SSQALLSQLYQSPNR.R O09032 ELAV-like protein 4 K.DAEK#AINTLNGLR.L P62630 Elongation factor 1-alpha 1 R.QTVAVGVIK#AVDK.K P62630 Elongation factor 1-alpha 1 K.FEK#EAAEMGK.G P62630 Elongation factor 1-alpha 1 K.AAGAGK#VTK.S P62630 Elongation factor 1-alpha 1 K.MDSTEPPYSQK#R.Y P62632 Elongation factor 1-alpha 2 K.SGGAGK#VTK.S P05197 Elongation factor 2 K.FAAK#GEGQLGAAER.A P05197 Elongation factor 2 R.YFDPANGK#FSK.S P05197 Elongation factor 2 R.VAVEAK#NPADLPK.L D4A612 Elongation of very long chain fatty acids (FEN1/Elo2, K.K#PM%KKEM%PEGAAGK.E Q9QYC5 Endothelin B receptor-like protein 2 K.AEVSSSIYFHK#PR.E Q5BKC9 Ephexin-1 R.DK#STLQEIETR.R O88339 Epsin 1 K.DFQYVDRDGK#DQGVNVR.E O88339 Epsin 1 K.NIVHNYSEAEIK#VR.E Q5RKI1 Eukaryotic initiation factor 4A-II R.GIYAYGFEK#PSAIQQR.A Q5RKI1 Eukaryotic initiation factor 4A-II K.GVAINFVTEEDK#R.I Q1JU68 Eukaryotic translation initiation factor 3 subunit A R.EQPEK#EPELQQYVPQLQNNTILR.L Q1JU68 Eukaryotic translation initiation factor 3 subunit A R.QSVYEEK#LK.Q P24942 Excitatory amino acid transporter 1 K.KPYQLIAQDNEPEK#PVADSETK.M P24942 Excitatory amino acid transporter 1 K.K#PYQLIAQDNEPEKPVADSETK.M P24942 Excitatory amino acid transporter 1 K.KPYQLIAQDNEPEKPVADSETK#M.P24942 Excitatory amino acid transporter 1 K.K#PYQLIAQDNEPEKPVADSETKM%.P24942 Excitatory amino acid transporter 1 K.K#PYQLIAQDNEPEKPVADSETKM.F1M9A6 Excitatory amino acid transporter 2 R.M%HEDIEM%TK#TQSIYDDTK.N F1M9A6 Excitatory amino acid transporter 2 R.M%HEDIEMTK#TQSIYDDTK.N F1M9A6 Excitatory amino acid transporter 2 R.MHEDIEMTK#TQSIYDDTK.N R.MHEDIEM%TK#TQSIYDDTK.N F1M9A6 Excitatory amino acid transporter 2 F1M9A6 Excitatory amino acid transporter 2 R.M%HDSHLSSEEPK#HR.N R.MHDSHLSSEEPK#HR.N F1M9A6 Excitatory amino acid transporter 2 F1M9A6 Excitatory amino acid transporter 2 K.TQSIYDDTK#NHR.E P31596 Excitatory amino acid transporter 2 -.A]STEGANNMPK#QVEVR.M Excitatory amino acid transporter 2 -.A]STEGANNM%PK#QVEVR.M P31596 P31596 Excitatory amino acid transporter 2 R.M%HEDIEM%TK#TQSVYDDTK.N P31596 Excitatory amino acid transporter 2 R.M%HEDIEMTK#TQSVYDDTK.N P31596 Excitatory amino acid transporter 2 R.MHEDIEMTK#TQSVYDDTK.N Excitatory amino acid transporter 2 R.MHEDIEM%TK#TQSVYDDTK.N P31596 P31596 Excitatory amino acid transporter 2 K.TQSVYDDTK#NHR.E B2GUW4 Exdl2 protein K.GIGELVSK#EPFVVR.L B2GUW4 Exdl2 protein K.QQLAK#EFQAPIGSEEGLR.L K.K#DVYTIFDTEVESTSPK.S B5DEY3 Exoc6b protein D4AE98 Exosome component 8 (Predicted), isoform CRA_a -.M%AAGFK#TVEPLEYYRR.F Q9Z1X1 Extended synaptotagmin-1 K.YVK#GLIEGK.S P31977 Ezrin K.EAQDDLVK#TK.E F-actin-capping protein subunit alpha-1 K.IDWNK#ILSYK.I B2GUZ5 Q5XI32 F-actin-capping protein subunit beta R.STLNEIYFGK#TK.D B2GUZ9 Fam49b protein R.FDELK#MTNPAIQNDFSYYR.R B2GUZ9 Fam49b protein R.FDELK#M%TNPAIQNDFSYYR.R Fam49b protein K.LQEK#AWGAVVPLVGK.L B2GUZ9 B2GUZ9 Fam49b protein R.EAIQHPADEK#LQEK.A B0BN65 Family with sequence similarity 49, member A K.HLNDESTSK#QIR.A K.K#DAPAVPSAPPSYEEATSGEGLK.A O88407 Fas apoptotic inhibitory molecule 2 O88407 Fas apoptotic inhibitory molecule 2 K.LSVANK#APGTEGQQQANGEK.K K.APGTEGQQQANGEK#K.D O88407 Fas apoptotic inhibitory molecule 2 O88407 Fas apoptotic inhibitory molecule 2 K.LSVANK#APGTEGQQQANGEKK.D Q924K2 FAS-associated factor 1 K.TGDVEDSTVLK#SLHLPK.N P85845 Fascin R.K#VTGTLDANR.S Fatty acid synthase K.LQEMSSK#AGSDTELAAPK.S P12785 NP_001099907.1 FH2 domain-containing protein 1 R.EILK#LLPESEEVK.K O55145 Fractalkine R.K#M%AGEM%VEGLR.Y O55145 Fractalkine R.K#MAGEMVEGLR.Y O55145 Fractalkine R.K#MAGEM%VEGLR.Y R.K#M%AGEMVEGLR.Y O55145 Fractalkine P05065 Fructose-bisphosphate aldolase A K.GGVVGIK#VDK.G P05065 Fructose-bisphosphate aldolase A R.IVAPGK#GILAADESTGSIAK.R Fructose-bisphosphate aldolase A K.VDK#GVVPLAGTNGETTTQGLDGLSER.C P05065 P05065 Fructose-bisphosphate aldolase A K.GILAADESTGSIAK#R.L P05065 Fructose-bisphosphate aldolase A K.DGADFAK#WR.C Fructose-bisphosphate aldolase A K.ENLK#AAQEEYIK.R P05065 P05065 Fructose-bisphosphate aldolase A K.AAQEEYIK#R.A P05065 Fructose-bisphosphate aldolase A R.ALQASALK#AWGGK.K P05065 Fructose-bisphosphate aldolase A K.K#DGADFAK.W P05065 Fructose-bisphosphate aldolase A K.K#ELADIAHR.I Fructose-bisphosphate aldolase C K.GILVGIK#VDK.G P09117 P09117 Fructose-bisphosphate aldolase C R.TIQEK#GILVGIK.V P09117 Fructose-bisphosphate aldolase C R.IVAPGK#GILAADESVGSMAK.R Fructose-bisphosphate aldolase C R.DNAGAATEEFIK#R.A P09117

2.023 2.023 2.632 2.632 2.632 2.632 2.583 2.583 4.946 4.946 4.946 4.946 4.946 4.946 4.946 1.92 1.92 1.92 1.92 1.92 1.92 2.479 3.609 2.358 2.358 2.358 2.358 2.358 2.358 2.636 2.352 1.959 2.321 2.197 3.018 3.018 3.629 2.034 2.034 3.025 3.244 1.971 2.652 2.652 2.652 2.652 2.681 2.681 2.681 2.681 2.853 2.034 3.944 3.699 4.387 2.921 4.049 3.253 3.16 3.16 2.4 2.4 2.4 2.4 2.885 3.084 3.084 3.084 1.79 2.282 3.354 2.919 2.919 2.163 2.163 2.383 2.383 3.821 3.821 3.821 3.821 3.821 2.806 2.806 2.806 2.806 2.806 2.806 2.806 4.055 4.055 4.055 4.055 4.055 4.055 4.055 2.028 2.028 2.959 2.577 2.441 2.581 2.215 3.403 2.329 2.329 2.329 2.329 2.935 5.184 5.184 5.184 5.184 2.661 2.326 3.226 1.678 2.055 2.055 2.055 2.055 1.668 1.668 1.668 1.668 1.668 1.668 1.668 1.668 1.668 1.668 3.035 3.035 3.035 3.035

0.218 0.218 0.248 0.248 0.248 0.248 0.076 0.076 0.65 0.65 0.65 0.65 0.65 0.65 0.65 0.495 0.495 0.495 0.495 0.495 0.495 0.581 0.481 0.268 0.268 0.268 0.268 0.268 0.268 0.059 0.22 0.02 0.267 0.545 0.337 0.337 0.651 0.39 0.39 0.452 0.479 0.019 0.17 0.17 0.17 0.17 0.331 0.331 0.331 0.331 0.368 0.513 0.602 0.688 0.177 0.113 0.725 0.668 0.464 0.464 0.385 0.385 0.385 0.385 0.43 0.447 0.447 0.447 0.064 0.374 0.391 0.346 0.346 0.292 0.292 0.155 0.155 0.226 0.226 0.226 0.226 0.226 0.442 0.442 0.442 0.442 0.442 0.442 0.442 0.13 0.13 0.13 0.13 0.13 0.13 0.13 0.473 0.473 0.307 0.062 0.283 0.341 0.553 0.135 0.236 0.236 0.236 0.236 0.543 0.633 0.633 0.633 0.633 0.343 0.323 0.248 0.225 0.276 0.276 0.276 0.276 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.221 0.5 0.5 0.5 0.5

3 3 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 2 3 2 3 4 3 3 2 2 2 2 2 2 2 3 3 3 2 4 2 3 3 2 2 3 3 4 4 4 4 4 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 4 3 2 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 3 3 3 3

417.8925 417.8925 629.8268 629.8268 629.8268 629.8268 662.0127 662.0127 616.9745 616.9745 616.9745 616.9745 616.9745 616.9745 616.9745 680.3622 680.3622 680.3622 680.3622 680.3622 680.3622 632.6551 920.7542 594.3152 594.3152 594.3152 594.3152 594.3152 594.3152 582.3198 485.9354 509.6181 530.8035 771.9015 594.0067 594.0067 607.6662 552.9737 552.9737 615.8197 590.3062 689.0209 710.3406 710.3406 710.3406 710.3406 566.2777 566.2777 566.2777 566.2777 641.6565 735.3856 656.2919 819.9316 586.9491 495.5134 638.6808 911.7929 764.9076 764.9076 458.7644 458.7644 458.7644 458.7644 459.7541 489.2709 489.2709 489.2709 824.4116 409.4625 717.3657 709.0071 709.0071 796.4073 796.4073 413.2189 413.2189 687.0898 687.0898 687.0898 687.0898 687.0898 796.3767 796.3767 796.3767 796.3767 796.3767 796.3767 796.3767 767.6724 767.6724 767.6724 767.6724 767.6724 767.6724 767.6724 705.6977 705.6977 691.6719 516.0109 374.2164 630.8253 465.255 757.8962 583.9639 583.9639 583.9639 583.9639 514.5917 757.0546 757.0546 757.0546 757.0546 651.6801 396.8824 659.6572 547.641 450.8874 450.8874 450.8874 450.8874 483.2385 483.2385 483.2385 483.2385 483.2385 483.2385 483.2385 483.2385 483.2385 483.2385 682.0301 682.0301 682.0301 682.0301


Page 36 of 60 3 1 13 3 1 1 17 3 24 10 9 6 4 4 3 9 8 7 2 1 1 1 1 4 2 2 1 1 1 2 5 3 1 1 2 1 4 12 2 2 1 1 21 6 3 2 6 5 1 1 1 3 1 3 1 4 5 4 8 3 6 5 1 1 1 11 10 2 1 1 1 1 1 7 1 8 2 11 10 1 1 1 27 16 11 9 8 7 5 11 9 8 4 3 1 1 2 1 2 1 2 1 5 3 6 3 2 1 1 12 12 4 1 1 1 1 2 10 9 2 2 16 15 14 12 9 9 8 3 2 2 28 11 9 8

12 12 18 18 18 18 20 20 60 60 60 60 60 60 60 28 28 28 28 28 28 1 1 11 11 11 11 11 11 2 5 3 1 1 3 3 4 14 14 2 1 1 32 32 32 32 13 13 13 13 1 3 1 3 1 4 5 4 11 11 13 13 13 13 1 23 23 23 1 1 1 2 2 8 8 10 10 24 24 24 24 24 83 83 83 83 83 83 83 37 37 37 37 37 37 37 3 3 2 1 2 1 5 3 12 12 12 12 1 29 29 29 29 1 1 1 2 23 23 23 23 90 90 90 90 90 90 90 90 90 90 61 61 61 61


Page 37 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P09117 Q91XV6 Q6AYD5 P62813 P62813 P62813 P62813 P23576 O88871 O88871 Q9Z0U4 Q9Z0U4 Q99MZ4 D4A5X7 D4A5X7 P08050 P08050 P08050 P08050 P08050 P08050 P08050 P08033 P08033 P08033 P08033 Q80XF7 Q80XF7 Q6AZ42 Q6AZ42 Q6AZ42 F1LPT0 Q68FP1 Q68FP1 Q68FP1 Q68FP1 Q68FP1 D3ZXW4 P47819 P47819 P47819 P47819 P47819 P47819 P47819 P47819 P47819 B5DEZ6 Q6P6V0 Q6P6V0 Q6P6V0 P19492 P19492 P19491 P19491 P09606 P09606 Q812E8 F8WFP3 P04797 P04797 P04797 P04797 P04797 P04797 F1LU03 F1LUZ8 Q63060 Q63060 O35077 P53534 P53534 B0BNM9 Q812E9 Q812E9 Q812E9 Q6AYQ1 B2RZ13 B2RZ13 B2RZ13 B2RZ13 Q8K3V3 Q8K3V3 Q9JHZ4 Q9JHZ4 P62994 P62828 P62828 Q9WTT6 P10824 P10824 P10824 P10824 P10824 P43425 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P59215 P82471 P82471 P63095 P19627 P19627 P63245 P62882 B2GUW3 O88600 D3ZC55 B4F772 B4F772 B4F772 Q66HA8 P34058 P34058 P34058 P34058 B4F7C7 P01946 P01946 P02091 P11517 P11517 P11517 P11517


Fructose-bisphosphate aldolase C R.IVAPGK#GILAADESVGSM%AK.R FXYD domain-containing ion transport regulator 6 R.APGDEEAQVENLITTNAAEPQK#AEN. G1 to S phase transition 1 R.KGEFETGFEK#GGQTR.E GABA (A) receptor subunit alpha-1 R.GDPGLATIAK#SATIEPK.E GABA (A) receptor subunit alpha-1 K.EVKPETK#PPEPK.K GABA (A) receptor subunit alpha-1 K.K#TFNSVSK.I GABA (A) receptor subunit alpha-1 K.EVK#PETKPPEPK.K GABA (A) receptor subunit alpha-2 K.DPVLSTISK#SATTPEPNK.K GABA (B) receptor subunit 2 R.MK#ITELDK.D GABA (B) receptor subunit 2 K.EDSK#TSTSVTSVNQASTSR.L Gamma-aminobutyric acid type B receptor subunit 1 K.IIAEK#EER.V Gamma-aminobutyric acid type B receptor subunit 1 K.TGSSTNNNEEEK#SR.L Gamma-glutamyltransferase 7 R.K#DEDAFLGDPDTDPDSFLK.S Ganglioside-induced differentiation-associated-protei K.K#ILDELEK.V Ganglioside-induced differentiation-associated-protei K.LAEENPDLQEAYIAK#QK.R Gap junction alpha-1 protein R.NYNK#QASEQNWANYSAEQNR.M Gap junction alpha-1 protein K.FK#YGIEEHGK.V Gap junction alpha-1 protein K.LNKK#EEELK.V K.VAQTDGVNVEM%HLK#QIEIK.K Gap junction alpha-1 protein Gap junction alpha-1 protein K.VAQTDGVNVEMHLK#QIEIK.K Gap junction alpha-1 protein K.VAQTDGVNVEM%HLK#QIEIKK.F Gap junction alpha-1 protein K.VAQTDGVNVEMHLK#QIEIKK.F Gap junction beta-1 protein K.LLSEQDGSLK#DILR.R Gap junction beta-1 protein K.QNEINK#LLSEQDGSLK.D Gap junction beta-1 protein R.LEGHGDPLHLEEVK#R.H Gap junction beta-1 protein R.LSPEYK#QNEINK.L Gap junction gamma-2 protein K.GGGGDGK#TVVTPGPAGQHDGR.R Gap junction gamma-2 protein R.SGAQEQLATK#PR.V Gap junction protein K.ESK#QNEMNELISDSGQNAITSFPS.Gap junction protein R.NHPNHALK#ESK.Q Gap junction protein K.RNEFK#DLEDIKR.Q Gap junction protein (Fragment) K.DTTDDLSVVETK#EPF.Gelsolin K.TASDFISK#MQYPR.Q Gelsolin K.TASDFISK#M%QYPR.Q Gelsolin K.TEALTSAK#R.Y Gelsolin K.GGVASGFK#HVVPNEVVVQR.L Gelsolin K.ATQVSK#GIRDNER.S Glial cells missing homolog 2 (Drosophila) (PredictedK.RQMASFYQPQK#R.R Glial fibrillary acidic protein R.FASYIEK#VR.F Glial fibrillary acidic protein R.FLEQQNK#ALAAELNQLR.A Glial fibrillary acidic protein R.K#LLEGEENR.I Glial fibrillary acidic protein R.K#IHEEEVR.E Glial fibrillary acidic protein R.ETSLDTK#SVSEGHLK.R Glial fibrillary acidic protein R.AKEPTK#LADVYQAELR.E Glial fibrillary acidic protein K.EPTK#LADVYQAELR.E Glial fibrillary acidic protein R.LEEEGQSLK#EEMAR.H Glial fibrillary acidic protein R.SK#FADLTDVASR.N Glucosamine-6-phosphate deaminase 2 K.YVK#TFNMDEYVGLPR.N Glucose-6-phosphate isomerase K.EWFLQAAK#DPSAVAK.H Glucose-6-phosphate isomerase R.K#ELQAAGK.S Glucose-6-phosphate isomerase K.LLPHK#VFEGNRPTNSIVFTK.L AMPA receptor GluR3 K.NTQNFK#PAPATNTQNYATYR.E AMPA receptor GluR3 R.EGYNVYGTESVK#I.Glutamate receptor 2 K.VAK#NPQNINPSSSQNSQNFATYK.E Glutamate receptor 2 K.EGYNVYGIESVK#I.Glutamine synthetase R.AYDPK#GGLDNAR.R Glutamine synthetase R.IVGQEK#K.G Glutamine-dependent NAD(+) synthetase R.ILK#SIQIAK.G Glyceraldehyde-3-phosphate dehydrogenase R.GAHLK#GGAK.R Glyceraldehyde-3-phosphate dehydrogenase R.GAAQNIIPASTGAAK#AVGK.V Glyceraldehyde-3-phosphate dehydrogenase K.VVK#QAAEGPLK.G Glyceraldehyde-3-phosphate dehydrogenase K.AGAHLK#GGAK.R Glyceraldehyde-3-phosphate dehydrogenase K.TVDGPSGK#LWR.D Glyceraldehyde-3-phosphate dehydrogenase R.LEK#PAKYDDIK.K Glyceraldehyde-3-phosphate dehydrogenase K.KVVK#QAAEGPLK.G Glyceraldehyde-3-phosphate dehydrogenase (FragmK.VVK#QASDSPLK.G Glyceraldehyde-3-phosphate dehydrogenase (FragmK.K#WHDGHEAAQNIILSSTGATK.A Glycerol kinase R.DNLGIIK#SSEEIEK.L Glycerol kinase R.TQSTVEK#LSK.R Glycerol-3-phosphate dehydrogenase R.K#LTEIINTQHENVK.Y Glycogen phosphorylase, brain form (Fragment) K.FQNK#TNGITPR.R Glycogen phosphorylase, brain form (Fragment) -.A]K#PLTDSER.Q Glycolipid transfer protein K.AALYAAPYK#SDFLK.A Glycoprotein m6a K.SK#EEQELHDIHSTR.S Glycoprotein m6a K.YEDIK#SKEEQELHDIHSTR.S Glycoprotein m6a R.MQK#YEDIK.S Golgin subfamily A member 7 K.VSK#YIQEQNEK.I Gprc5b protein (Fragment) R.AYMENK#AFSMDEHNAALR.S Gprc5b protein (Fragment) R.AYM%ENK#AFSMDEHNAALR.S Gprc5b protein (Fragment) R.AYMENK#AFSM%DEHNAALR.S Gprc5b protein (Fragment) R.AYM%ENK#AFSM%DEHNAALR.S G-protein coupled receptor 56 K.NNSDSAK#LPISSGSTSSSR. G-protein coupled receptor 56 K.NNSDSAK#LPISSGSTSSSRI.GRIP1-associated protein 1 R.EQNTELAAELK#HR.Q GRIP1-associated protein 1 R.K#SAIIETYVMDSR.I Growth factor receptor-bound protein 2 K.FGNDVQHFK#VLR.D GTP-binding nuclear protein Ran K.FNVWDTAGQEK#FGGLR.D GTP-binding nuclear protein Ran K.K#NLQYYDISAK.S Guanine deaminase R.VK#PIVTPR.F Guanine nucleotide-binding protein G(i) subunit alphaR.LK#IDFGDAAR.A Guanine nucleotide-binding protein G(i) subunit alphaK.K#DLFEEK.I Guanine nucleotide-binding protein G(i) subunit alphaK.DLFEEK#IK.K Guanine nucleotide-binding protein G(i) subunit alphaR.EVK#LLLLGAGESGK.S Guanine nucleotide-binding protein G(i) subunit alphaR.NLREDGEK#AAR.E Guanine nucleotide-binding protein G(I)/G(S)/G(O) suR.NDPLLVGVPASENPFK#DK.K Guanine nucleotide-binding protein G(o) subunit alphR.AM%DTLGVEYGDK#ER.K Guanine nucleotide-binding protein G(o) subunit alphR.AMDTLGVEYGDK#ER.K Guanine nucleotide-binding protein G(o) subunit alphK.DVK#LLLLGAGESGK.S Guanine nucleotide-binding protein G(o) subunit alphR.SREYQLNDSAK#YYLDSLDR.I Guanine nucleotide-binding protein G(o) subunit alphK.EDGISAAK#DVK.L Guanine nucleotide-binding protein G(o) subunit alphR.EYQLNDSAK#YYLDSLDR.I Guanine nucleotide-binding protein G(o) subunit alphK.NLK#EDGISAAK.D Guanine nucleotide-binding protein G(o) subunit alphK.K#DLFGEK.I Guanine nucleotide-binding protein G(o) subunit alphK.QM%K#IIHEDGFSGEDVK.Q Guanine nucleotide-binding protein G(o) subunit alphK.STIVK#QMK.I Guanine nucleotide-binding protein G(o) subunit alphK.NLKEDGISAAK#DVK.L Guanine nucleotide-binding protein G(o) subunit alphR.VK#TTGIVETHFTFK.N Guanine nucleotide-binding protein G(o) subunit alphK.QMK#IIHEDGFSGEDVK.Q Guanine nucleotide-binding protein G(o) subunit alphR.AMDTLGVEYGDK#ERK.A Guanine nucleotide-binding protein G(q) subunit alphR.EYQLSDSTK#YYLNDLDR.V Guanine nucleotide-binding protein G(q) subunit alphK.IPYK#YEHNK.A Guanine nucleotide-binding protein G(s) subunit alph K.IDVIK#QADYVPSDQDLLR.C Guanine nucleotide-binding protein G(z) subunit alph R.DMTTGIVENK#FTFK.E Guanine nucleotide-binding protein G(z) subunit alph R.DM%TTGIVENK#FTFK.E Guanine nucleotide-binding protein subunit beta-2-lik K.IIVDELK#QEVISTSSK.A R.AK#LHDVELHQVAER.V Guanine nucleotide-binding protein subunit betaHdac11 protein K.VINFLK#EEK.L Heat shock 70 kDa protein 4 K.LNLQNK#QSLTADPVVK.T Heat shock 70kDa protein 12A (Predicted), isoform CR.YVEGK#HPPEK.L Heat shock 70kDa protein 4-like (Predicted), isoform R.DK#LGTVYEK.F Heat shock 70kDa protein 4-like (Predicted), isoform K.LGTVYEK#FITPEDM%NK.L Heat shock 70kDa protein 4-like (Predicted), isoform K.LGTVYEK#FITPEDMNK.L Heat shock protein 105 kDa K.ENLSYDLVPMK#NGGVGIK.V Heat shock protein HSP 90-beta R.GTK#VILHLK.E Heat shock protein HSP 90-beta K.ADLINNLGTIAK#SGTK.A Heat shock protein HSP 90-beta K.EK#YIDQEELNK.T Heat shock protein HSP 90-beta K.K#HLEINPDHPIVETLR.Q Hebp1 protein K.FATVEVTDK#PVDEALR.E Hemoglobin subunit alpha-1/2 K.AADHVEDLPGALSTLSDLHAHK#LR.V Hemoglobin subunit alpha-1/2 K.K#VADALAK.A Hemoglobin subunit beta-1 K.AAVNGLWGK#VNPDDVGGEALGR.L Hemoglobin subunit beta-2 K.VINAFNDGLK#HLDNLK.G Hemoglobin subunit beta-2 R.YFSK#FGDLSSASAIMGNPQVK.A Hemoglobin subunit beta-2 K.VVAGVASALAHK#YH.Hemoglobin subunit beta-2 K.K#VINAFNDGLK.H

3.035 3.908 2.602 2.001 2.001 2.001 2.001 4.793 2.11 2.11 2.904 2.904 2.16 4.178 4.178 4.531 4.531 4.531 4.531 4.531 4.531 4.531 2.609 2.609 2.609 2.609 2.225 2.225 2.139 2.139 2.139 3.872 3.09 3.09 3.09 3.09 3.09 2.018 2.331 2.331 2.331 2.331 2.331 2.331 2.331 2.331 2.331 2.453 2.185 2.185 2.185 2.027 2.027 2.336 2.336 2.435 2.435 2.402 2.497 2.54 2.54 2.54 2.54 2.54 2.54 1.889 2.467 1.824 1.824 2.428 1.868 1.868 2.432 1.827 1.827 1.827 3.386 4.152 4.152 4.152 4.152 3.188 3.188 2.234 2.234 2.308 3.714 3.714 1.692 1.686 1.686 1.686 1.686 1.686 3.601 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.126 2.79 2.79 3.11 1.926 1.926 2.554 2.822 2.731 2.967 2.146 2.316 2.316 2.316 2.393 2.7 2.7 2.7 2.7 3.459 1.999 1.999 3.812 2.481 2.481 2.481 2.481

0.5 0.471 0.329 0.367 0.367 0.367 0.367 0.416 0.396 0.396 0.458 0.458 0.61 0.055 0.055 0.253 0.253 0.253 0.253 0.253 0.253 0.253 0.336 0.336 0.336 0.336 0.214 0.214 0.257 0.257 0.257 0.59 0.397 0.397 0.397 0.397 0.397 0.034 0.359 0.359 0.359 0.359 0.359 0.359 0.359 0.359 0.359 0.711 0.299 0.299 0.299 0.296 0.296 0.405 0.405 0.191 0.191 0.228 0.306 0.235 0.235 0.235 0.235 0.235 0.235 0.231 0.203 0.117 0.117 0.113 0.335 0.335 0.098 0.346 0.346 0.346 0.287 0.719 0.719 0.719 0.719 0.315 0.315 0.186 0.186 0.684 0.409 0.409 0.318 0.152 0.152 0.152 0.152 0.152 0.011 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.3 0.333 0.333 0.312 0.078 0.078 0.3 0.321 0.33 0.292 0.343 0.339 0.339 0.339 0.203 0.154 0.154 0.154 0.154 0.477 0.303 0.303 0.662 0.374 0.374 0.374 0.374

3 3 3 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 3 2 3 3 3 3 3 3 2 3 3 3 3 2 2 3 2 2 2 2 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 2 3 3 2 2 2 3 4 4 4 4 3 2 2 3 2 2 2 2

682.0301 918.4332 595.6222 512.773 512.773 512.773 512.773 1000.021 364.5294 364.5294 556.2462 556.2462 747.004 692.0199 692.0199 804.0938 804.0938 804.0938 804.0938 804.0938 804.0938 804.0938 526.2693 526.2693 526.2693 526.2693 467.2468 467.2468 463.5722 463.5722 463.5722 905.4221 529.9437 529.9437 529.9437 529.9437 529.9437 827.4167 582.9707 582.9707 582.9707 582.9707 582.9707 582.9707 582.9707 582.9707 582.9707 649.3201 479.7691 479.7691 479.7691 786.8806 786.8806 792.8988 792.8988 458.2663 458.2663 376.5763 476.7696 461.2765 461.2765 461.2765 461.2765 461.2765 461.2765 643.3582 793.3989 563.6276 563.6276 594.323 586.7975 586.7975 557.9639 584.7875 584.7875 584.7875 740.3756 748.6667 748.6667 748.6667 748.6667 670.3226 670.3226 542.9429 542.9429 525.2783 728.875 728.875 512.3188 568.3046 568.3046 568.3046 568.3046 568.3046 685.3567 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 524.7954 653.3328 653.3328 734.7173 582.2906 582.2906 635.0177 586.9791 617.3444 628.0184 433.2221 583.8057 583.8057 583.8057 683.3532 507.0277 507.0277 507.0277 507.0277 635.3313 465.2746 465.2746 770.391 666.8671 666.8671 666.8671 666.8671


5 5 1 5 2 1 1 3 1 1 2 1 1 2 1 6 4 4 3 2 1 1 4 2 2 1 2 1 2 1 1 5 32 21 5 2 1 2 17 10 5 4 3 2 1 1 1 1 3 1 1 12 8 12 5 8 1 1 5 22 18 9 8 3 2 1 1 1 1 1 2 1 1 11 6 1 8 6 3 2 1 3 3 9 1 1 3 1 2 15 10 1 1 1 7 44 29 25 22 17 15 13 2 2 1 1 1 1 1 3 2 1 2 2 1 1 6 5 1 1 1 1 3 9 4 2 1 1 8 1 1 7 5 2 1

61 5 1 9 9 9 9 3 2 2 3 3 1 3 3 21 21 21 21 21 21 21 9 9 9 9 3 3 4 4 4 5 61 61 61 61 61 2 44 44 44 44 44 44 44 44 44 1 5 5 5 20 20 17 17 9 9 1 5 62 62 62 62 62 62 1 1 2 2 1 3 3 1 18 18 18 8 12 12 12 12 6 6 10 10 1 4 4 2 28 28 28 28 28 7 174 174 174 174 174 174 174 174 174 174 174 174 174 174 5 5 1 4 4 1 1 6 5 1 3 3 3 3 16 16 16 16 1 9 9 1 15 15 15 15



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q9JJ50 Q9JJ50 Q9JJ50 Q9JJ50 P17132 P61980 A7VJC2 P05708 P05708 P05708 P05708 P05708 P05708 P05708 P05708 P05708 P63159 P62749 P62749 P62749 P62749 P06349 P06349 B1WC28 D3ZWE0 D3ZXP3 Q02874 Q02874 Q02874 Q02874 P02262 Q64598 P0C0S7 D3ZZP9 Q00715 Q00715 Q00715 Q00715 P84245 Q9Z214 Q9Z214 Q9Z214 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 G3V8Y8 Q5EAJ6 P29994 P15127 P35559 Q4KLJ2 Q5XIE8 Q5PQL7 Q5PQL7 Q5PQL7 Q5PQL7 B2RYB8 Q7TP98 Q9JIL3 Q63621 P52191 O54902-2 P97829-2 P97829-2 P02688-2 P02688-2 P02688-2 Q63610-2 Q3ZB98-3 Q9JI66-3 Q9JI66-3 Q9JI66-3 Q9JI66-3 P22199-3 P07722-2 P07722-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64542-2 Q64568-10 Q64568-10 Q64568-10 Q64568-10 Q64568-10 Q64568-10 Q64568-10 Q68FQ2 Q69FB3 G3V6L4 G3V6L4 G3V6L4 G3V6L4 G3V6L4 P70615 P70615 Q68FQ9 Q68FQ9 Q64654 Q64654 P48450 Q6MG49 O88917 O88917 G3V881 Q32Q07 Q5FVI3 Q3KRC6

Hepatocyte growth factor-regulated tyrosine kinase s K.YK#VVQDTYQIMK.V Hepatocyte growth factor-regulated tyrosine kinase s K.KAEGK#AASTTELPPEYLTSPLSQQSQLPPK.R Hepatocyte growth factor-regulated tyrosine kinase s K.FGIEK#EVR.V Hepatocyte growth factor-regulated tyrosine kinase s K.YK#VVQDTYQIM%K.V Heterogeneous nuclear ribonucleoprotein C (Fragme K.IFVGGLSPDTPEEK#IR.E Heterogeneous nuclear ribonucleoprotein K K.DLAGSIIGK#GGQR.I Heterogeneous nuclear ribonucleoproteins A2/B R.EESGKPGAHVTVK#K.L Hexokinase-1 K.ATVK#MLPSFVR.S Hexokinase-1 K.QTLM%EVK#K.R Hexokinase-1 R.NILIDFTK#K.G Hexokinase-1 K.ASGVEGADVVK#LLNK.A Hexokinase-1 R.GK#FNTSDVSAIEK.D Hexokinase-1 K.ATVK#M%LPSFVR.S Hexokinase-1 K.LLNK#AIK.K Hexokinase-1 K.QTLMEVK#K.R Hexokinase-1 R.DYNPTASVK#MLPTFVR.S High mobility group protein B1 K.IK#GEHPGLSIGDVAK.K Hippocalcin-like protein 1 K.K#IYANFFPYGDASK.F Hippocalcin-like protein 1 K.MVSSVM%K#M%PEDESTPEK.R Hippocalcin-like protein 1 R.GAK#SDPSIVR.L Hippocalcin-like protein 1 K.MVSSVMK#MPEDESTPEK.R Histone H1t K.K#ALAAAGYDVEK.N Histone H1t K.ALAAAGYDVEK#NNSR. Histone H2A R.IHPELLAK#K.R Histone H2A K.K#TDSHKPGK.N Histone H2A K.K#TSATVGPK.A Histone H2A K.GVTIASGGVLPNIHPELLAK#K.R Histone H2A K.GK#LEAIITPPPAK.K Histone H2A K.GVTIASGGVLPNIHPELLAK#KR.G Histone H2A K.GVTIASGGVLPNIHPELLAKK#R.G Histone H2A type 1 K.K#TESHHK.A Histone H2A type 1-F K.K#TESHHKPK.G Histone H2A.Z K.KGQQK#TV.Histone H2B K.AVTK#YTSAK.Histone H2B K.AVTK#YTSSK.I Histone H2B R.LLLPGELAK#HAVSEGTK.A Histone H2B K.HAVSEGTK#AVTK.Y Histone H2B K.VLK#QVHPDTGISSK.A Histone H3.3 R.EIAQDFK#TDLR.F Homer protein homolog 1 K.LTAALLESTANVK#QWK.Q Homer protein homolog 1 R.NK#DLEGQLSELEQR.L K.GNNAK#LTAALLESTANVK.Q Homer protein homolog 1 Hsc70, heat shock cognate 71 kDa protein K.VSSK#NSLESYAFNM%K.A Hsc70, heat shock cognate 71 kDa protein K.NQVAMNPTNTVFDAK#R.L Hsc70, heat shock cognate 71 kDa protein K.VSSK#NSLESYAFNMK.A Hsc70, heat shock cognate 71 kDa protein R.MVQEAEK#YK.A Hsc70, heat shock cognate 71 kDa protein R.M%VQEAEK#YK.A Hsc70, heat shock cognate 71 kDa protein K.ITITNDK#GR.L Hsc70, heat shock cognate 71 kDa protein K.NQVAM%NPTNTVFDAK#R.L Hsc70, heat shock cognate 71 kDa protein R.IINEPTAAAIAYGLDK#K.V Hsc70, heat shock cognate 71 kDa protein R.MVQEAEK#YKAEDEK.Q Hsc70, heat shock cognate 71 kDa protein K.VQVEYK#GETK.S Hsc70, heat shock cognate 71 kDa protein R.QATK#DAGTIAGLNVLR.I Hsc70, heat shock cognate 71 kDa protein K.EEFEHQQK#ELEK.V Hsc70, heat shock cognate 71 kDa protein R.LSK#EDIER.M Hsc70, heat shock cognate 71 kDa protein R.LIGDAAK#NQVAMNPTNTVFDAK.C Hsc70, heat shock cognate 71 kDa protein K.GRLSK#EDIER.M Hsc70, heat shock cognate 71 kDa protein R.GTLDPVEK#ALR.D Hsc70, heat shock cognate 71 kDa protein K.ENK#ITITNDK.G Hsc70, heat shock cognate 71 kDa protein R.AMTK#DNNLLGK.F Hsc70, heat shock cognate 71 kDa protein K.ALRDAK#LDK.S Hsc70, heat shock cognate 71 kDa protein R.M%VQEAEK#YKAEDEK.Q Hsc70, heat shock cognate 71 kDa protein K.NQTAEKEEFEHQQK#ELEK.V Hsc70, heat shock cognate 71 kDa protein R.LIGDAAK#NQVAM%NPTNTVFDAK.C Huntingtin interacting protein 1, isoform CRA_a R.MEYHTK#NPR.F Inhibitor of nuclear factor kappa-B kinase-interacting K.VAAPEPEK#RSDGR.K Inositol 1,4,5-trisphosphate receptor type 1 K.IGTSPLK#EDK.E Insulin receptor R.VAVK#TVNESASLR.E Insulin-degrading enzyme K.IVPIK#DIR.N Integral membrane protein 2A K.IAFNTPTAVQK#EEAR.Q Integral membrane protein 2B K.VTFNSALAQK#EAK.K Integral membrane protein 2C K.ISFQPAVAGVK#AEK.A Integral membrane protein 2C K.ADK#AAASGPASASAPAAEILLTPAR.E Integral membrane protein 2C K.ADK#AAASGPASASAPAAEILLTPAREERPPR.H Integral membrane protein 2C K.ADK#AAASGPASASAPAAEILLT$PAR.E Integrin beta K.SQWNNDNPLFK#SATTTVMNPK.F Interleukin enhancer-binding factor 2 R.VK#PAPDETSFSEALLK.R Interleukin enhancer-binding factor 3 R.VGLVAK#GLLLK.G Interleukin-1 receptor accessory protein R.WSSSDK#QGLSYSSLK.N Inward rectifier potassium channel 16 K.QLDWK#DQQLNNLEK.T Isoform 1 of Natural resistance-associated macrophaK.VLLSEDTSGGNTK#.Isoform 2 of Leukocyte surface antigen CD47 K.AVEEPLNAFK#ESK.G Isoform 2 of Leukocyte surface antigen CD47 R.K#AVEEPLNAFK.E Isoform 2 of Myelin basic protein S K.RGSGK#DSHTR.T Isoform 2 of Myelin basic protein S R.TTHYGSLPQK#SQR.T R.FSWGAEGQK#PGFGYGGR.A Isoform 2 of Myelin basic protein S Isoform 2 of Tropomyosin alpha-3 chain K.TIDDLEDELYAQK#LK.Y Isoform 3 of Breast carcinoma-amplified sequence 1 K.DAENSPTTPANLK#SDK.A Isoform 3 of Electrogenic sodium bicarbonate cotransK.DK#VTYTLLR.K Isoform 3 of Electrogenic sodium bicarbonate cotransR.SPVK#VVPQIR.I Isoform 3 of Electrogenic sodium bicarbonate cotransK.DK#VTYTLLRK.H Isoform 3 of Electrogenic sodium bicarbonate cotransR.SLADIGK#TVSSASR.M Isoform 3 of Mineralocorticoid receptor K.QMIQVVK#WAKNLK.T Isoform S-MAG of Myelin-associated glycoprotein K.K#NVTESPSFSAGDNPHVLYSPEFR. R.ISGAPDK#YESR.E Isoform S-MAG of Myelin-associated glycoprotein Isoform XA of Plasma membrane calcium-transportinK.TSPVEGLSGNPADLEK#R.R Isoform XA of Plasma membrane calcium-transportinR.ILNK#EGGIVPFK.T Isoform XA of Plasma membrane calcium-transportinK.GEVEQEK#LDK.V Isoform XA of Plasma membrane calcium-transportinR.LK#TSPVEGLSGNPADLEK.R Isoform XA of Plasma membrane calcium-transportinK.TLDK#DPMLLSGTHVMEGSGR.M Isoform XA of Plasma membrane calcium-transportinR.SEM%PEEK#LFK.V Isoform XA of Plasma membrane calcium-transportinR.SEMPEEK#LFK.V Isoform XA of Plasma membrane calcium-transportinR.NEK#GEVEQEK.L Isoform XA of Plasma membrane calcium-transportinR.LIRNEK#GEVEQEK.L Isoform XA of Plasma membrane calcium-transportinK.LDK#VWPR.L Isoform XA of Plasma membrane calcium-transportinK.TSPVEGLSGNPADLEK#RR.L Isoform XA of Plasma membrane calcium-transportinK.TQDGVALEIQPLNSQEGLDSEEK#EK.K Isoform ZE of Plasma membrane calcium-transportin K.GEIEQERLDK#VWPK.L Isoform ZE of Plasma membrane calcium-transportin R.IRNEK#GEIEQERLDK.V Isoform ZE of Plasma membrane calcium-transportin R.NEK#GEIEQERLDK.V Isoform ZE of Plasma membrane calcium-transportin K.TSPTEGLADNTNDLEK#R.R Isoform ZE of Plasma membrane calcium-transportin R.LK#TSPTEGLADNTNDLEK.R Isoform ZE of Plasma membrane calcium-transportin -.G]DMANSSIEFHPK#PQQQR.E Isoform ZE of Plasma membrane calcium-transportin K.TSPTEGLADNTNDLEK#RR.Q Junctional adhesion molecule C K.SPGK#HEGVNYIR.T K.AVAASSVAEK#AVEAAR.M Junctophilin-4 Kinesin family member 5C (Predicted) K.VSK#TGAEGAVLDEAK.N Kinesin family member 5C (Predicted) K.EK#YDEEITSLYR.Q Kinesin family member 5C (Predicted) K.LSGK#LYLVDLAGSEK.V Kinesin family member 5C (Predicted) K.TGAEGAVLDEAK#NINK.S R.NGEAVPEDEQISAK#DQK.N Kinesin family member 5C (Predicted) Lamin-B1 K.K#SLEGDLEDLK.D Lamin-B1 K.K#QLADETLLK.V LanC lantibiotic synthetase component C-like 2 (BactK.VDQETLTEMVK#PSIDYVR.H LanC lantibiotic synthetase component C-like 2 (BactK.IVPNLIK#R.I Lanosterol 14-alpha demethylase R.YLQDNPASGEK#FAYVPFGAGR.H K.GVAYDVPNAVFLEQK#K.I Lanosterol 14-alpha demethylase Lanosterol synthase R.LSQVPDNNPDYQK#YYR.H Large proline-rich protein BAG6 K.EHIAASVSIPSEK#QR.L Latrophilin-1 R.K#QTESSFMAGDINSTPTLNR.G Latrophilin-1 R.K#QTESSFM%AGDINSTPTLNR.G R.K#SDAGISSADAPR.K Leucine rich repeat neuronal 6A, isoform CRA_a Leucine-rich repeat neuronal protein 1 K.DGSADTK#PTQVDTSR.S Leucine-rich repeat-containing protein 57 R.HLDVVDLSK#NQIR.S Leucine-rich repeat-containing protein 8E R.K#LVILR.L

1.889 1.889 1.889 1.889 3.45 2.945 2.689 1.657 1.657 1.657 1.657 1.657 1.657 1.657 1.657 1.657 2.589 2.267 2.267 2.267 2.267 4.564 4.564 2.82 2.363 2.305 2.107 2.107 2.107 2.107 2.09 2.434 1.638 3.069 2.109 2.109 2.109 2.109 2.604 2.307 2.307 2.307 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 1.864 2.492 1.84 1.762 2.457 1.827 2.708 3.391 3.257 3.257 3.257 3.257 2.835 3.298 2.568 2.694 2.552 2.983 2.641 2.641 2.336 2.336 2.336 2.235 2.902 1.87 1.87 1.87 1.87 1.955 2.356 2.356 2.308 2.308 2.308 2.308 2.308 2.308 2.308 2.308 2.308 2.308 2.308 2.308 3.108 3.108 3.108 3.108 3.108 3.108 3.108 3.749 2.832 2.482 2.482 2.482 2.482 2.482 2.824 2.824 1.68 1.68 2.911 2.911 3.702 2.978 2.623 2.623 2.733 3.232 2.702 1.81

0.162 0.162 0.162 0.162 0.503 0.409 0.572 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.286 0.162 0.154 0.154 0.154 0.154 0.627 0.627 0.141 0.337 0.499 0.461 0.461 0.461 0.461 0.225 0.361 0.236 0.619 0.224 0.224 0.224 0.224 0.398 0.148 0.148 0.148 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.608 0.595 0.217 0.032 0.422 0.154 0.243 0.553 0.32 0.32 0.32 0.32 0.5 0.658 0.324 0.476 0.101 0.691 0.191 0.191 0.415 0.415 0.415 0.021 0.099 0.397 0.397 0.397 0.397 0.092 0.474 0.474 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.476 0.544 0.544 0.544 0.544 0.544 0.544 0.544 0.396 0.13 0.166 0.166 0.166 0.166 0.166 0.354 0.354 0.327 0.327 0.041 0.041 0.613 0.398 0.333 0.333 0.279 0.666 0.197 0.208

3 3 3 3 3 2 3 2 2 2 2 2 2 2 2 2 3 3 3 3 3 2 2 3 2 2 3 3 3 3 2 2 2 2 3 3 3 3 2 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 3 2 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 2 2 2 2 4 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 3 3 2 3 3 3 3 2 3 2

364.5335 364.5335 364.5335 364.5335 624.6653 693.3776 527.6177 457.2948 457.2948 457.2948 457.2948 457.2948 457.2948 457.2948 457.2948 457.2948 545.6333 690.9729 690.9729 690.9729 690.9729 846.9187 846.9187 388.2363 556.2968 501.7811 795.4618 795.4618 795.4618 795.4618 490.7491 603.3237 451.7559 541.7957 541.6341 541.6341 541.6341 541.6341 725.3702 643.6852 643.6852 643.6852 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 659.843 430.5392 763.3875 601.3248 496.6108 534.3337 596.9796 507.606 834.4209 834.4209 834.4209 834.4209 836.4034 615.9905 408.9394 596.291 629.3182 717.8574 453.914 453.914 638.9665 638.9665 638.9665 636.6574 601.2903 618.8748 618.8748 618.8748 618.8748 425.747 668.8275 668.8275 514.29 514.29 514.29 514.29 514.29 514.29 514.29 514.29 514.29 514.29 514.29 514.29 711.0168 711.0168 711.0168 711.0168 711.0168 711.0168 711.0168 490.9193 548.6287 657.9796 657.9796 657.9796 657.9796 657.9796 636.8605 636.8605 533.8406 533.8406 631.335 631.335 1057.4998 589.3107 776.368 776.368 463.5645 846.3961 550.9681 428.2927


Page 38 of 60 3 2 1 1 4 1 1 9 4 3 3 3 2 1 1 1 1 13 1 1 1 2 1 3 3 46 70 41 2 1 2 3 1 23 269 18 12 4 2 8 2 1 19 17 17 16 15 12 12 11 8 6 6 4 3 3 2 2 2 1 1 1 1 1 2 1 1 1 1 5 12 68 27 6 1 1 3 7 1 2 1 6 5 2 2 1 2 1 10 1 1 1 1 14 4 20 5 5 4 3 2 2 2 2 1 1 1 15 12 6 6 3 2 1 2 15 7 4 4 3 1 3 2 3 1 5 2 6 7 9 2 1 1 16 1

7 7 7 7 4 1 1 27 27 27 27 27 27 27 27 27 1 16 16 16 16 3 3 3 3 46 114 114 114 114 2 3 1 23 303 303 303 303 2 11 11 11 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 160 2 1 1 1 1 5 12 102 102 102 102 1 3 7 1 2 1 11 11 5 5 5 2 1 13 13 13 13 1 18 18 48 48 48 48 48 48 48 48 48 48 48 48 45 45 45 45 45 45 45 2 15 19 19 19 19 19 5 5 4 4 7 7 6 7 11 11 1 1 16 1


Page 39 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q7TMB7 P97544 P97544 P97544 Q5U2U6 P04642 P04642 P04642 P42123 P42123 P42123 P42123 P42123 P42123 P42123 B2RYA8 B2RYA8 Q924N5 Q924N5 Q924N5 Q6P501 O88989 O88989 O88989 Q5XIC1 O08873 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 F1LRL9 P43244 D4ABB2 D4ABB2 D4ABB2 O88382 Q6AYF7 P34926 P34926 P34926 P34926 P15146 P15146 Q63560 Q63560 Q63560 Q63560 Q63560 Q63560 Q63560 Q3B8Q0 Q3B8Q0 Q5XIT1 P19332 P84817 P62078 A4F267 Q75Q39 Q5XIG9 Q7TSA0 P49186 D3ZTD1 O35763 P53987 P53987 P08482 P08482 O08839 O08839 P60203 P07722 P07722 Q63327 Q63327 P02600 Q64119 Q9ERE6 Q63357 Q63357 Q6MG60 Q6MG60 Q9JJ19 Q9JJ19 D3ZME8 D3ZME8 D3ZME8 D3ZME8 P13697 P00388 Q501R9 P55161 P55161 P55161 Q5U2S1 Q5U2S1 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q99MI7 P13596 P13596 P13596 P13596 P13596 P13596 P13596 P13596 P13596 Q63374 Q63374 Q5PQN0 O35095 O35095 P19527 P12839 P12839 P12839 P12839 Q04940 Q62888 P07936 P07936 P07936 P07936


Lipid phosphate phosphatase-related protein type 4 R.DASSLTNLK#R.A Lipid phosphate phosphohydrolase 3 K.YDK#AIVPESK.N Lipid phosphate phosphohydrolase 3 K.AIVPESK#NGGSPALNNNPR.K Lipid phosphate phosphohydrolase 3 -.M]QSYK#YDK.A LITAF-like protein -.S]NEPPPPYPGGPTAPLLEEK#SGAPHTPGR.T L-lactate dehydrogenase A chain R.QVVDSAYEVIK#LK.G L-lactate dehydrogenase A chain K.TPK#IVSSK.V L-lactate dehydrogenase A chain K.SLNPQLGTDADK#EQWK.D L-lactate dehydrogenase B chain R.GLTSVINQK#LK.D L-lactate dehydrogenase B chain K.MVVDSAYEVIK#LK.G L-lactate dehydrogenase B chain K.M%VVDSAYEVIK#LK.G L-lactate dehydrogenase B chain R.GLTSVINQK#LKDDEVAQLRK.S L-lactate dehydrogenase B chain K.SADTLWDIQK#DLK.D L-lactate dehydrogenase B chain K.EK#LIAPVADDETAVPNNK. L-lactate dehydrogenase B chain R.GLTSVINQKLK#DDEVAQLRK.S LOC689593 protein K.EVAEAYEVLSDK#HK.R LOC689593 protein K.EVAEAYEVLSDK#HKR.E Long-chain-fatty-acid--CoA ligase ACSBG1 R.VGSK#ASTVSEIVGQK.D Long-chain-fatty-acid--CoA ligase ACSBG1 R.ANVIVVDTQK#QLEK.I Long-chain-fatty-acid--CoA ligase ACSBG1 K.ESPSHGLELSAPEK#AR.A Lysosomal-associated transmembrane protein 4A K.IPEK#EPPPPYLPA.Malate dehydrogenase, cytoplasmic K.LQGK#EVGVYEALK.D K.SQGAALEK#YAK.K Malate dehydrogenase, cytoplasmic Malate dehydrogenase, cytoplasmic R.AK#SQIALK.L Mannose-1-phosphate guanyltransferase alpha K.VAPSAVLGPNVSIGK#GVTIGEGVR.L MAP kinase-activating death domain protein R.QTPFAEK#LAR.T MAP1 light chain LC1 K.DIK#PQLELIEDEEK.L MAP1 light chain LC1 K.LK#ETEPGEAYVIQK.E MAP1 light chain LC1 K.ETEPGEAYVIQK#ETEVSK.G MAP1 light chain LC1 R.TPEEGGYSYEISEK#TTR.T MAP1 light chain LC1 K.QPLATQK#DLTGQVSTPPVK.Q MAP1 light chain LC1 K.DLTGQVSTPPVK#QVK.L MAP1 light chain LC1 K.ITK#TPQASTYSYETSDR.C MAP1 light chain LC1 R.TPEVSGYTYEK#TER.S MAP1 light chain LC1 K.DFEELK#AEEIDVAK.D MAP1 light chain LC1 K.ITSFPESESYSYETTTK#TTR.S MAP1 light chain LC1 K.LEMYVLNPVK#SSK.E Matrin-3 K.FLNK#LAEER.R Megalencephalic leukoencephalopathy with subcorticK.K#GSISDGTNILDEVTFPAR.V Megalencephalic leukoencephalopathy with subcorticR.SPLK#EFDK.E Megalencephalic leukoencephalopathy with subcorticR.QDTGSYTPDTKPK#DLQLTK.R Membrane-associated guanylate kinase, WW and PDR.DASQLK#GTFLSTTLK.K Microfibril-associated glycoprotein 3 K.LQK#AFEIAK.R Microtubule-associated protein 1A K.DFQEPLPQK#GLEVER.W Microtubule-associated protein 1A K.DLAAGAVPANLK#PSK. Microtubule-associated protein 1A R.SPWTSDFK#DFQEPLPQK.G Microtubule-associated protein 1A R.YPVATQK#DLAAGAVPANLKPSK. Microtubule-associated protein 2 K.K#DEWGLAAPISPGPLTPMR.E Microtubule-associated protein 2 K.VTGGQTTQVETSSESPFPAK#EYYK.N Microtubule-associated protein 6 R.GPIQLSADARDPEGAGGAGVPAAGK#ASGADQR Microtubule-associated protein 6 R.TEGHEEK#PLPPAQSQTQEGGPAAGK.A Microtubule-associated protein 6 R.DPEGAGGAGVPAAGK#ASGADQR.D Microtubule-associated protein 6 R.AWTDIKPVK#PIK.A Microtubule-associated protein 6 R.K#AGPAWMVTR.T Microtubule-associated protein 6 K.GEASK#PTTADNK.V Microtubule-associated protein 6 K.GEASKPTTADNK#VVDR.R Microtubule-associated protein RP/EB family membe K.FYDANYDGK#EYDPVEAR.Q Microtubule-associated protein RP/EB family membe K.K#FYDANYDGK.E Microtubule-associated protein RP/EB family membe K.ERDFYFSK#LR.D Microtubule-associated protein tau R.LQTAPVPMPDLK#NVR.S Mitochondrial fission 1 protein R.GLLQTEPQNNQAK#ELER.L Mitochondrial import inner membrane translocase su R.FAQIVQK#GGQ.Mitochondrial import receptor subunit TOM40B K.DVFPAQMEGVK#LVVNK.V Mitochondrial import receptor subunit TOM70 K.QDLDK#GLELISK.A Mitochondrial protein 18 kDa K.K#AGEVPSPEAGR.S Mitochondrial Rho GTPase 2 R.DRDAPEK#LPTHTINTVR.V Mitogen-activated protein kinase 9 K.VIEQLGTPSAEFMK#K.L Mitogen-activated protein kinase kinase kinase 14 (P R.VGRGSFGEVHRM%K#DK.Q Moesin R.VLEQHK#LNK.D Monocarboxylate transporter 1 K.SDANTDLIGGSPK#GEK.L Monocarboxylate transporter 1 K.ESLQEAGK#SDANTDLIGGSPK.G Muscarinic acetylcholine receptor M1 R.ELAALQGSETPGK#GGGSSSSSER.S Muscarinic acetylcholine receptor M1 K.MPMVDSEAQAPTK#QPPK.S Myc box-dependent-interacting protein 1 K.QHGSNTFTVK#AQPSDSAPEK.G Myc box-dependent-interacting protein 1 -.A]EMGSK#GVTAGK.I Myelin proteolipid protein K.GLSATVTGGQK#GR.G Myelin-associated glycoprotein R.ISGAPDKYESEK#R.L Myelin-associated glycoprotein R.ISGAPDK#YESEK.R Myelin-associated oligodendrocyte basic protein R.SPPIPAK#PR.S Myelin-associated oligodendrocyte basic protein K.SPPRPAK#PR.S Myosin light chain 1/3, skeletal muscle isoform R.HVLATLGEK#MK.E Myosin light polypeptide 6 K.NK#DQGTYEDYVEGLR.V Myosin phosphatase Rho-interacting protein K.GWLTK#QYEDGQWK.K Myosin-Id K.NMWPEGK#LSITEVTK.R Myosin-Id R.VGAQLK#SSINDAAEFK.V N(G),N(G)-dimethylarginine dimethylaminohydrolase R.TVVAGSSEAAQK#AVR.A N(G),N(G)-dimethylarginine dimethylaminohydrolase R.K#ALQDLGLR.I Na(+)/H(+) exchange regulatory cofactor NHE-RF1 R.LVEPGSPAEK#SGLLAGDR.L Na(+)/H(+) exchange regulatory cofactor NHE-RF1 K.LLVVDK#ETDEFFK.K NAD-dependent deacetylase sirtuin-2 R.NLFTQTLGLGSQK#ER.L NAD-dependent deacetylase sirtuin-2 K.K#HPEPFFALAK.E NAD-dependent deacetylase sirtuin-2 K.K#ELEDLVR.R NAD-dependent deacetylase sirtuin-2 R.LLINK#EK.T NADP-dependent malic enzyme K.IAVK#IVQDAYK.E NADPH--cytochrome P450 reductase R.HLMHLELDISDSK#IR.Y Nbr1, neighbor of Brca1 gene 1 R.VLGSDMK#TTEEPTAEAR.S Nck-associated protein 1 K.LAEK#LTILNDR.G Nck-associated protein 1 R.TSFDK#PDQMAALFK.R Nck-associated protein 1 R.SVLQPSQQK#LAEK.L NEDD4 family-interacting protein 1 K.DESGFPK#PPSYNVATTLPSYDEAER.T NEDD4 family-interacting protein 1 R.TK#AEATIPLVPGR.D Nedd8 K.TLTGK#EIEIDIEPTDK.V Nedd8 K.TLTGK#EIEIDIEPTDKVER.I Nedd8 K.EIEIDIEPTDK#VER.I Nedd8 R.LIYSGK#QMNDEK.T Nedd8 K.QMNDEK#TAADYK.I Nedd8 K.QM%NDEK#TAADYK.I Nedd8 R.LIYSGK#QM%NDEK.T Nedd8 R.IK#ERVEEK.E R.LTQGVVK#R.I NEDD8-activating enzyme E1 Neural cell adhesion molecule 1 K.DESK#EPIVEVR.T Neural cell adhesion molecule 1 K.DMEEGK#AAFSK.D Neural cell adhesion molecule 1 K.DM%EEGK#AAFSK.D Neural cell adhesion molecule 1 K.HTEPNETTPLTEPEK#GPVETK.S Neural cell adhesion molecule 1 K.TVPNEATQTK#ENESKA.Neural cell adhesion molecule 1 K.GPVETK#SEPQESEAKPAPTEVK.T Neural cell adhesion molecule 1 K.AAFSKDESK#EPIVEVR.T Neural cell adhesion molecule 1 K.GK#DM%EEGK.A Neural cell adhesion molecule 1 K.SEPQESEAK#PAPTEVK.T Neurexin-2-alpha R.NYISNSAQSNGAVVK#EK.A K.APAAPK#TPSK.A Neurexin-2-alpha Neurocalcin-delta K.K#IYGNFFPYGDASK.F Neurochondrin K.AGDIDAK#TR.R R.NPALK#LAAR.L Neurochondrin Neurofilament light polypeptide R.AQYEK#LAAK.N Neurofilament medium polypeptide K.AVEEMITITK#SVK.V Neurofilament medium polypeptide K.AVEEM%ITITK#SVK.V Neurofilament medium polypeptide R.K#LLEGEETR.L Neurofilament medium polypeptide K.SVK#VSLEK.D Neurogranin R.K#GPGPGGPGGAGGAR.G Neuroligin-2 R.ELPPEEELVSLQLK#R.G Neuromodulin K.EK#DDAPVADGVEK.K Neuromodulin K.AATK#IQASFR.G Neuromodulin K.AGSAETESAAK#ATTDNSPSSK.A Neuromodulin K.IEQDGVK#PEDK.A

1.899 2.134 2.134 2.134 5.247 2.35 2.35 2.35 1.855 1.855 1.855 1.855 1.855 1.855 1.855 4.132 4.132 2.602 2.602 2.602 2.127 1.67 1.67 1.67 5.544 1.711 2.021 2.021 2.021 2.021 2.021 2.021 2.021 2.021 2.021 2.021 2.021 2.505 2.222 2.222 2.222 2.44 2.289 2.727 2.727 2.727 2.727 3.813 3.813 2.044 2.044 2.044 2.044 2.044 2.044 2.044 2.518 2.518 2.584 2.533 2.32 2.942 2.846 2.573 1.997 2.73 2.972 2.489 2.035 2.861 2.861 2.453 2.453 2.518 2.518 3.099 2.768 2.768 2.141 2.141 1.772 3.671 2.32 2.354 2.354 2.898 2.898 2.624 2.624 1.766 1.766 1.766 1.766 2.754 1.933 2.885 2.759 2.759 2.759 2.284 2.284 2.028 2.028 2.028 2.028 2.028 2.028 2.028 2.028 2.222 2.092 2.092 2.092 2.092 2.092 2.092 2.092 2.092 2.092 1.949 1.949 2.344 2.291 2.291 2.054 1.707 1.707 1.707 1.707 3.347 3.872 2.149 2.149 2.149 2.149

0.169 0.317 0.317 0.317 0.616 0.229 0.229 0.229 0.157 0.157 0.157 0.157 0.157 0.157 0.157 0.086 0.086 0.112 0.112 0.112 0.278 0.025 0.025 0.025 0.76 0.391 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.339 0.2 0.2 0.2 0.096 0.23 0.413 0.413 0.413 0.413 0.09 0.09 0.072 0.072 0.072 0.072 0.072 0.072 0.072 0.404 0.404 0.547 0.589 0.303 0.4 0.248 0.457 0.222 0.228 0.4 0.045 0.117 0.672 0.672 0.221 0.221 0.33 0.33 0.497 0.304 0.304 0.299 0.299 0.193 0.429 0.471 0.178 0.178 0.576 0.576 0.372 0.372 0.155 0.155 0.155 0.155 0.247 0.18 0.275 0.298 0.298 0.298 0.382 0.382 0.552 0.552 0.552 0.552 0.552 0.552 0.552 0.552 0.309 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.423 0.236 0.236 0.384 0.223 0.223 0.246 0.282 0.282 0.282 0.282 0.627 0.664 0.073 0.073 0.073 0.073

2 2 2 2 3 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 4 4 4 4 4 4 4 2 2 3 3 3 2 3 3 2 4 3 3 2 3 3 3 3 2 2 2 3 3 3 3 2 3 3 3 3 3 3 3 3 2 2 2 2 3 3 3 2 2 2 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 3 3 3 2 2 2 2 2 2 2 3 3 3 3 3 3

609.8264 609.7826 609.7826 609.7826 1036.1841 487.2877 487.2877 487.2877 549.6154 549.6154 549.6154 549.6154 549.6154 549.6154 549.6154 629.9893 629.9893 607.9742 607.9742 607.9742 781.416 640.3354 640.3354 640.3354 797.7852 425.5658 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 814.7147 411.8921 359.8572 359.8572 359.8572 575.3134 581.3348 722.0153 722.0153 722.0153 722.0153 916.7722 916.7722 378.2255 378.2255 378.2255 378.2255 378.2255 378.2255 378.2255 667.8037 667.8037 492.2518 598.3295 694.6909 595.3193 630.0038 491.6038 656.3355 520.024 597.9824 611.6464 611.8497 744.3637 744.3637 656.9896 656.9896 646.3172 646.3172 673.3621 479.8996 479.8996 373.8838 373.8838 670.8715 634.2938 584.9488 616.317 616.317 529.9531 529.9531 566.2977 566.2977 486.2985 486.2985 486.2985 486.2985 454.5972 641.0047 650.3154 785.4333 785.4333 785.4333 489.6147 489.6147 515.2283 515.2283 515.2283 515.2283 515.2283 515.2283 515.2283 515.2283 338.873 512.2245 512.2245 512.2245 512.2245 512.2245 512.2245 512.2245 512.2245 512.2245 361.2049 361.2049 574.2827 530.772 530.772 568.3094 502.2926 502.2926 502.2926 502.2926 436.2258 632.0136 569.9598 569.9598 569.9598 569.9598


1 4 3 2 7 2 1 1 24 7 6 3 1 1 1 2 1 9 6 4 32 34 1 1 5 1 25 10 9 5 3 3 3 2 2 1 1 3 8 1 1 1 11 6 4 1 1 3 2 4 4 2 1 1 1 1 2 1 1 2 5 1 1 2 1 3 1 1 1 6 1 4 1 2 1 13 2 1 6 1 1 1 1 1 1 1 1 3 2 18 9 9 1 3 2 1 23 7 3 13 6 33 22 15 13 5 3 3 3 6 11 8 4 4 3 3 2 1 1 3 1 12 1 1 1 6 2 2 1 2 10 4 4 4 4

1 9 9 9 7 4 4 4 43 43 43 43 43 43 43 3 3 19 19 19 32 36 36 36 5 1 64 64 64 64 64 64 64 64 64 64 64 3 10 10 10 1 11 12 12 12 12 5 5 14 14 14 14 14 14 14 3 3 1 2 5 1 1 2 1 3 1 1 1 7 7 5 5 3 3 13 3 3 7 7 1 1 1 2 2 2 2 5 5 37 37 37 37 3 2 1 33 33 33 19 19 97 97 97 97 97 97 97 97 6 37 37 37 37 37 37 37 37 37 4 4 12 2 2 1 11 11 11 11 2 10 27 27 27 27



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P07936 P07936 P07936 P07936 P07936 P07936 P07936 P07936 P07936 Q9WU34 Q9WU34 P02683 P58821 P58821 P35439 G3V746 G3V746 G3V746 G3V746 G3V746 Q9QUL6 Q9QUL6 Q9QUL6 Q9QUL6 Q9QUL6 Q9QUL6 P37199 P61972 Q05982 P19804 P19804 P19804 P19804 P19804 Q9Z2G8 Q5PPG6 D4AE91 Q8R5M4 Q9EPX4 Q920Q0 Q5XI55 Q5XI55 P14925 P10111 Q62658 Q62915 Q62915 D4A5T8 D4A5T8 Q63716 Q9WTR8 P16446 P16617 P16617 P16617 P16617 P16617 P16617 P25113 P25113 P25113 P25113 P25113 P25113 P13286 D3ZHJ1 D3ZHJ1 Q568Z9 Q568Z9 Q568Z9 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11505 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P11506 P47987 P63004 P63004 P63004 P63004 P63004 P63004 Q9EPH8 P85125 P85125 P85125 P10499 P63142 P63142 P63142 P15385 P17659 P22462 O54852 O88943 O88943 O88943 O88943

Neuromodulin K.NDEDQK#IEQDGVKPEDK.A Neuromodulin K.IEQDGVKPEDK#AHK.A Neuromodulin K.KGDAPAAEAEAK#EK.D Neuromodulin K.IEQDGVK#PEDKAHK.A Neuromodulin K.EGDGSATTDAAPATSPK#AEEPSK.A Neuromodulin K.K#EGDGSATTDAAPATSPK.A Neuromodulin K.NDEDQKIEQDGVK#PEDK.A Neuromodulin K.K#GDAPAAEAEAK.E Neuromodulin K.KGEGDAAPSEEK#AGSAETESAAK.A Neuronal-specific septin-3 R.K#ELEVNGIEFYPQK.E Neuronal-specific septin-3 R.VRK#ELEVNGIEFYPQK.E Neuron-specific protein family member 1 K.LGNNFAEK#GTK.Q Neuron-specific vesicular protein calcyon K.TQTEYQLTSADQPK#K.F Neuron-specific vesicular protein calcyon K.K#FADLEGQR.L NMDA receptor subunit NR1 R.GALQNQK#DTVLPR.R NMDA receptor subunit NR2B R.DK#EGLRDFYLDQFR.T NMDA receptor subunit NR2B K.HSQLSDLYGK#FSFK.S NMDA receptor subunit NR2B K.K#PLDIGLPSSK.H R.ALVTNK#PVVSALHGAVPGR.F NMDA receptor subunit NR2B NMDA receptor subunit NR2B K.KPLDIGLPSSK#HSQLSDLYGK.F NSF, vesicle-fusing ATPase K.VEVDMEK#AESLQVTR.G NSF, vesicle-fusing ATPase K.VEVDM%EK#AESLQVTR.G NSF, vesicle-fusing ATPase K.ASTK#VEVDMEK.A NSF, vesicle-fusing ATPase R.VLDDGELLVQQTK#NSDR.T NSF, vesicle-fusing ATPase K.ASTK#VEVDM%EK.A NSF, vesicle-fusing ATPase K.AENSSLNLIGK#AK.T Nuclear pore complex protein Nup155 R.NSQFSGGPLGNPNTTAK#VQQR.L Nuclear transport factor 2 K.AAIVEK#LSSLPFQK.I Nucleoside diphosphate kinase A K.FIQASEDLLK#EHYIDLK.D Nucleoside diphosphate kinase B R.VM%LGETNPADSK#PGTIR.G Nucleoside diphosphate kinase B R.ASEEHLK#QHYIDLK.D Nucleoside diphosphate kinase B R.TFIAIK#PDGVQR.G Nucleoside diphosphate kinase B K.QHYIDLK#DRPFFPGLVK.Y Nucleoside diphosphate kinase B R.VMLGETNPADSK#PGTIR.G Nucleosome assembly protein 1-like 1 R.K#YAVLYQPLFDK.R Nucleosome assembly protein 1-like 5 K.FDK#EFQALEK.K Olfactory receptor 1645 (Predicted) R.NEDMKSALNK#LIR.R Optineurin K.QLQMDEMK#QTIAK.Q P2Y purinoceptor 12 K.K#GQEGGDPSEETPM.Paralemmin-1 K.K#VLGLQDTIK.A Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagineR.KLDK#GTK.V Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagineR.ETINGLNK#QR.Q Peptidyl-glycine alpha-amidating monooxygenas R.K#LESSSGR.V K.SIYGEK#FEDENFILK.H Peptidyl-prolyl cis-trans isomerase A Peptidyl-prolyl cis-trans isomerase FKBP1A K.FTLGK#QEVIR.G R.ETGQQFAVK#IVDVAK.F Peripheral plasma membrane protein CASK Peripheral plasma membrane protein CASK K.LENSK#NGTAGLIPSPELQEWR.V Periplakin (Predicted) K.IQK#ELEEEM%ER.R Periplakin (Predicted) K.LLYVLEADSAIAK#HM%K.H Peroxiredoxin-1 K.DISLSDYK#GK.Y PH domain leucine-rich repeat protein phosphatase R.LLQLGHK#GGGVVK.V Phosphatidylinositol transfer protein alpha isoform R.SQVLSK#DYK.A Phosphoglycerate kinase 1 K.AEPAK#IDAFR.A Phosphoglycerate kinase 1 R.VDFNVPM%K#NNQITNNQR. Phosphoglycerate kinase 1 R.VDFNVPMK#NNQITNNQR. Phosphoglycerate kinase 1 K.IVK#DLMAK.A Phosphoglycerate kinase 1 K.VK#AEPAK.I Phosphoglycerate kinase 1 K.VLNNMEIGTSLYDEEGAK#IVK.D Phosphoglycerate mutase 1 -.A]AYK#LVLIR.H Phosphoglycerate mutase 1 K.AETAAK#HGEAQVK.I Phosphoglycerate mutase 1 K.HGEAQVK#IWR.R Phosphoglycerate mutase 1 R.HYGGLTGLNK#AETAAK.H Phosphoglycerate mutase 1 K.AMEAVAAQGK#VK.K Phosphoglycerate mutase 1 R.K#AMEAVAAQGK.V Phosphorylase b kinase gamma catalytic chain, skeleR.IYGHWVKK#GQQQNR.A Phosphoserine aminotransferase K.AVELNMISLK#GHR.S Phosphoserine aminotransferase K.NNGGAAAMEK#LSSVK.S Phytanoyl-CoA hydroxylase-interacting protein K.EHLAQLQEK#AEQIAGR.M Phytanoyl-CoA hydroxylase-interacting protein K.LVAK#AVPLPMTVR.G Phytanoyl-CoA hydroxylase-interacting protein K.LVAK#AVPLPM%TVR.G Plasma membrane calcium-transporting ATPase 1 K.SLDK#DPLLLSGTHVMEGSGR.M Plasma membrane calcium-transporting ATPase 1 R.DRDDIVK#TVIEPMASEGLR.T Plasma membrane calcium-transporting ATPase 1 R.IEQEQK#FTVIR.G Plasma membrane calcium-transporting ATPase 1 K.ILPPEK#EGGLPR.H Plasma membrane calcium-transporting ATPase 1 K.AQDGAAMEMQPLK#SEEGGDGDEK.D Plasma membrane calcium-transporting ATPase 1 K.LK#TSPNEGLSGNPADLER.R Plasma membrane calcium-transporting ATPase 1 K.HTLVK#GIIDSTVSEQR.Q Plasma membrane calcium-transporting ATPase 1 K.AK#AQDGAAMEMQPLK.S Plasma membrane calcium-transporting ATPase 1 K.AQDGAAM%EMQPLK#SEEGGDGDEK.D Plasma membrane calcium-transporting ATPase 1 K.SLDK#DPLLLSGTHVM%EGSGR.M Plasma membrane calcium-transporting ATPase 1 K.K#QDGAIENR.N Plasma membrane calcium-transporting ATPase 1 R.DRDDIVK#TVIEPM%ASEGLR.T Plasma membrane calcium-transporting ATPase 1 K.AQDGAAM%EM%QPLK#SEEGGDGDEK.D Plasma membrane calcium-transporting ATPase 2 K.GEIEQERIDK#IWPK.L Plasma membrane calcium-transporting ATPase 2 R.QVVAVTGDGTNDGPALK#K.A Plasma membrane calcium-transporting ATPase 2 R.IDK#IWPK.L Plasma membrane calcium-transporting ATPase 2 K.TSPVEGLPGTAPDLEK#R.K Plasma membrane calcium-transporting ATPase 2 R.IRNEK#GEIEQER.I Plasma membrane calcium-transporting ATPase 2 R.SQMPEEK#LYK.V Plasma membrane calcium-transporting ATPase 2 -.G]DMTNSDFYSK#NQR.N Plasma membrane calcium-transporting ATPase 2 R.SSLYEGLEK#PESR.T Plasma membrane calcium-transporting ATPase 2 K.AK#QQDGAAAM%EM%QPLK.S Plasma membrane calcium-transporting ATPase 2 K.ILPPEK#EGALPR.Q Plasma membrane calcium-transporting ATPase 2 K.QQDGAAAMEMQPLK#SAEGGDADDK.K Plasma membrane calcium-transporting ATPase 2 R.SQM%PEEK#LYK.V Plasma membrane calcium-transporting ATPase 2 K.SVDK#DPMLLSGTHVMEGSGR.M Plasma membrane calcium-transporting ATPase 2 K.AK#QQDGAAAMEM%QPLK.S Plasma membrane calcium-transporting ATPase 2 K.K#ADVGFAMGIAGTDVAK.E Plasma membrane calcium-transporting ATPase 2 K.AK#QQDGAAAMEMQPLK.S Plasma membrane calcium-transporting ATPase 2 R.NEK#GEIEQER.I Plasma membrane calcium-transporting ATPase 2 R.LK#TSPVEGLPGTAPDLEK.R Plasma membrane calcium-transporting ATPase 2 K.AK#QQDGAAAM%EMQPLK.S Plasma membrane calcium-transporting ATPase 2 R.IEQEQK#FTVVR.A Plasma membrane calcium-transporting ATPase 2 K.QQDGAAAM%EMQPLK#SAEGGDADDK.K Plasma membrane calcium-transporting ATPase 2 -.G]DM%TNSDFYSK#NQR.N Plasma membrane calcium-transporting ATPase 2 R.NK#PLISR.T Plasma membrane calcium-transporting ATPase 2 K.QQDGAAAMEM%QPLK#SAEGGDADDK.K Plasma membrane calcium-transporting ATPase 2 K.TSPVEGLPGTAPDLEK#RK.Q Plasma membrane calcium-transporting ATPase 2 R.GTEAVVK#IK.E Plasma membrane calcium-transporting ATPase 2 K.QQDGAAAM%EM%QPLK#SAEGGDADDK.K Plasma membrane calcium-transporting ATPase 2 R.M%TVVQAYVGDVHYK#EIPDPSSINAK.T Plasma membrane calcium-transporting ATPase 2 R.LTQK#EEIPEEELNEDVEEIDHAER.E Plasmolipin -.A]EFPSK#VSTR.T Platelet-activating factor acetylhydrolase IB subunit aK.LNEAK#EEFTSGGPLGQK.R Platelet-activating factor acetylhydrolase IB subunit aK.K#EAELDMNEELDK.K Platelet-activating factor acetylhydrolase IB subunit aK.K#EAELDMNEELDKK.Y Platelet-activating factor acetylhydrolase IB subunit aK.EEFTSGGPLGQK#RDPK.E Platelet-activating factor acetylhydrolase IB subunit aK.EEFTSGGPLGQK#R.D Platelet-activating factor acetylhydrolase IB subunit aK.K#EAELDM%NEELDK.K Polyadenylate-binding protein 1 K.AK#EFTNVYIK.N Polymerase I and transcript release factor K.VMIYQDEVK#LPAK.L Polymerase I and transcript release factor K.LGK#AHATTSNTVSK.L Polymerase I and transcript release factor K.AHATTSNTVSK#LLEK.V Potassium voltage-gated channel subfamily A membeK.TLAQFPNTLLGNPK#K.R Potassium voltage-gated channel subfamily A membeK.TLAQFPETLLGDPK#K.R Potassium voltage-gated channel subfamily A membeK.TLAQFPETLLGDPK#KR.M Potassium voltage-gated channel subfamily A membeK.TLAQFPETLLGDPKK#R.M Potassium voltage-gated channel subfamily A membeK.TLAQFPETLLGDPEK#R.T Potassium voltage-gated channel subfamily A membeK.ATDNGLGK#PDFAEASR.E Potassium voltage-gated channel subfamily C memb K.RLGIEDAAGLGGPDGK#SGR.W Potassium voltage-gated channel subfamily H memb K.IPQLTLNFSDVK#TEK.K Potassium voltage-gated channel subfamily KQT me R.TK#GPAETELPEDPSMMGR.L Potassium voltage-gated channel subfamily KQT me R.DGALLIAGSEAPK#R.G Potassium voltage-gated channel subfamily KQT me R.TK#GPAETELPEDPSMM%GR.L Potassium voltage-gated channel subfamily KQT me K.QVLSMEK#K.L

2.149 2.149 2.149 2.149 2.149 2.149 2.149 2.149 2.149 3.951 3.951 2.84 2.19 2.19 3.045 2.809 2.809 2.809 2.809 2.809 2.669 2.669 2.669 2.669 2.669 2.669 3.562 2.17 2.121 2.081 2.081 2.081 2.081 2.081 2.877 2.445 1.759 2.019 1.791 2.363 2.114 2.114 2.249 2.929 2.706 3.714 3.714 2.084 2.084 1.938 3.338 2.896 1.878 1.878 1.878 1.878 1.878 1.878 2.129 2.129 2.129 2.129 2.129 2.129 1.791 3.706 3.706 2.902 2.902 2.902 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 2.942 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 1.654 2.146 2.608 2.608 2.608 2.608 2.608 2.608 2.067 1.96 1.96 1.96 3.993 3.168 3.168 3.168 2.038 2.62 3.48 3.854 1.601 1.601 1.601 1.601

0.073 0.073 0.073 0.073 0.073 0.073 0.073 0.073 0.073 0.403 0.403 0.319 0.262 0.262 0.405 0.468 0.468 0.468 0.468 0.468 0.24 0.24 0.24 0.24 0.24 0.24 0.34 0.491 0.567 0.149 0.149 0.149 0.149 0.149 0.612 0.229 0.213 0.265 0.75 0.298 0.29 0.29 0.288 0.451 0.353 0.558 0.558 0.186 0.186 0.082 0.283 0.204 0.193 0.193 0.193 0.193 0.193 0.193 0.123 0.123 0.123 0.123 0.123 0.123 0.134 0.374 0.374 0.598 0.598 0.598 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.246 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.333 0.374 0.358 0.358 0.358 0.358 0.358 0.358 0.176 0.145 0.145 0.145 0.014 0.643 0.643 0.643 0.457 0.543 0.42 0.025 0.083 0.083 0.083 0.083

3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 2 2 3 2 2 2 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 2 2 2 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2

569.9598 569.9598 569.9598 569.9598 569.9598 569.9598 569.9598 569.9598 569.9598 688.3696 688.3696 431.5577 589.3022 589.3022 777.4235 667.385 667.385 667.385 667.385 667.385 682.0143 682.0143 682.0143 682.0143 682.0143 682.0143 772.3876 548.9824 726.0473 729.7283 729.7283 729.7283 729.7283 729.7283 533.6236 684.8421 549.2934 839.4175 788.3365 410.2459 452.2666 452.2666 489.2545 649.3228 435.5835 818.4174 818.4174 521.9151 521.9151 620.3142 710.4247 591.3109 428.7479 428.7479 428.7479 428.7479 428.7479 428.7479 582.3037 582.3037 582.3037 582.3037 582.3037 582.3037 928.4872 795.8997 795.8997 508.9684 508.9684 508.9684 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 572.7889 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 471.2793 639.3278 565.2574 565.2574 565.2574 565.2574 565.2574 565.2574 442.9063 549.963 549.963 549.963 585.9951 643.3562 643.3562 643.3562 643.6755 588.2826 647.3359 616.3351 538.7919 538.7919 538.7919 538.7919


Page 40 of 60 3 1 1 1 1 1 1 1 1 46 17 6 6 3 2 3 3 2 1 1 20 10 4 1 1 1 3 2 1 7 5 3 1 1 3 1 1 1 1 2 2 2 2 2 1 3 1 1 1 1 4 1 20 6 4 2 1 1 54 13 3 1 1 1 1 4 2 17 6 5 10 8 6 4 4 4 3 3 2 2 1 1 1 50 18 10 8 8 7 6 5 5 4 4 3 3 3 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 5 20 12 6 5 4 3 2 1 1 1 11 11 2 1 1 1 1 2 6 4 2 1

27 27 27 27 27 27 27 27 27 63 63 6 9 9 2 10 10 10 10 10 37 37 37 37 37 37 3 2 1 17 17 17 17 17 3 1 1 1 1 2 4 4 2 2 1 4 4 2 2 1 4 1 34 34 34 34 34 34 73 73 73 73 73 73 1 6 6 28 28 28 49 49 49 49 49 49 49 49 49 49 49 49 49 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 157 5 50 50 50 50 50 50 2 3 3 3 11 14 14 14 1 1 1 2 16 16 16 16


Page 41 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


O88943 Potassium voltage-gated channel subfamily KQT me R.TK#GPAETELPEDPSM%M%GR.L O88943 Potassium voltage-gated channel subfamily KQT me R.TK#GPAETELPEDPSM%MGR.L O88943 Potassium voltage-gated channel subfamily KQT me R.TGGAGAGK#PPKR.N O88944 Potassium voltage-gated channel subfamily KQT me K.EQLEAAASQK#LGLLDR.V Q9JKB0 Potassium/sodium hyperpolarization-activated cyclic K.FQK#DLNTGVFNNQENEILK.Q Q9JKB0 Potassium/sodium hyperpolarization-activated cyclic R.QFTSM%LQPGVNK#FSLR.M Q9JKA9 Potassium/sodium hyperpolarization-activated cyclic R.QFGALLQPGVNK#FSLR.M Q9JKA9 Potassium/sodium hyperpolarization-activated cyclic R.MFGSQK#AVER.E Q9ES40 PRA1 family protein 3 K.FADYISK#ARE.XP_002726328.1 PREDICTED: ATPase, class II, type 9A R.FSPPSYSK#LTS.XP_002726328.1 PREDICTED: ATPase, class II, type 9A K.SSNIQVGDLILVEK#NQR.V XP_221100.5 PREDICTED: ATP-binding cassette, sub-family A (ABR.LADALK#LQDQLK.S XP_221100.5 PREDICTED: ATP-binding cassette, sub-family A (ABK.WK#LLPQEEA.XP_221100.5 PREDICTED: ATP-binding cassette, sub-family A (ABK.EQELDDFEEELDPSVK#WK.L XP_221100.5 PREDICTED: ATP-binding cassette, sub-family A (ABK.LEGK#SAIDSDIGETEDVQAGGTR.G XP_002728068.1 PREDICTED: brain protein 44 K.NSNLK#ESSK.R XP_221790.4 PREDICTED: CD209 molecule-like K.GSEVPTSQEHDHEK#QR. XP_001075972.1 PREDICTED: CG5555-like R.LVASK#TDGK.I XP_001073579.1 PREDICTED: DnaJ (Hsp40) homolog, subfamily B, mK.QVAEAYEVLSDAK#K.R XP_001073579.1 PREDICTED: DnaJ (Hsp40) homolog, subfamily B, mK.SLTINGK#EHLLR.L XP_001073579.1 PREDICTED: DnaJ (Hsp40) homolog, subfamily B, mK.QVAEAYEVLSDAKK#R.D XP_001073579.1 PREDICTED: DnaJ (Hsp40) homolog, subfamily B, mK.QVAEAYEVLSDAK#KR.D XP_002725075.1 PREDICTED: guanine nucleotide binding protein (G pK.LVEQLK#MEASIDR.I XP_002725075.1 PREDICTED: guanine nucleotide binding protein (G pK.LVEQLK#M%EASIDR.I XP_002725075.1 PREDICTED: guanine nucleotide binding protein (G pR.K#LVEQLK.M XP_002725075.1 PREDICTED: guanine nucleotide binding protein (G pR.KLVEQLK#M%EASIDR.I XP_002725075.1 PREDICTED: guanine nucleotide binding protein (G pR.KLVEQLK#MEASIDR.I XP_001075834.1 PREDICTED: hect (homologous to the E6-AP (UBE3K.TMVQGK#NYGPQITVK.R XP_001075834.1 PREDICTED: hect (homologous to the E6-AP (UBE3K.TM%VQGK#NYGPQITVK.R XP_001075834.1 PREDICTED: hect (homologous to the E6-AP (UBE3K.LRPNYDK#TEIEK.K XP_576802.3 PREDICTED: hypothetical protein K.K#SLHKDPPQAPM%.G XP_002726316.1 PREDICTED: rCG37290-like K.KVEQWK#EK.F XP_001056086.1 PREDICTED: regulator of G-protein signaling 6 isofo K.MQDDK#TGGVPIR.T XP_001070971.1 PREDICTED: regulator of nonsense transcripts 1-likeR.NMDSMPELQK#LQQLK.D XP_001070971.1 PREDICTED: regulator of nonsense transcripts 1-likeR.NM%DSM%PELQK#LQQLK.D XP_001070971.1 PREDICTED: regulator of nonsense transcripts 1-likeR.NM%DSMPELQK#LQQLK.D XP_001057026.1 PREDICTED: ribosomal protein S27a-like R.TLSDYNIQK#ESM%LHLVLR.L P48679 Prelamin-A/C K.EELDFQK#NIYSEELR.E Q9QZA2 Programmed cell death 6-interacting protein R.AVLDK#AVQADGQVK.E Q5HZA6 Prolyl endopeptidase-like K.LFEETGHEDPITK#TSR.V P83868 Prostaglandin E synthase 3 K.DVNVNFEK#SK.L R.LVSLIGSK#TQIPTQR.Y P18420 Proteasome 26S subunit, alpha type 1 P17220 Proteasome 26S subunit, alpha type 2 K.VEPITK#HIGLVYSGM%GPDYR.S K.VEPITK#HIGLVYSGMGPDYR.S P17220 Proteasome 26S subunit, alpha type 2 P60901 Proteasome 26S subunit, alpha type 6 R.ARYEAANWK#YK.Y R.YEAANWK#YK.Y P60901 Proteasome 26S subunit, alpha type 6 P60901 Proteasome 26S subunit, alpha type 6 K.ATAAGVK#QTESTSFLEK.K Q63347 Proteasome 26S subunit, ATPase, rpt1 K.IINADSEDPK#YIINVK.Q Q63347 Proteasome 26S subunit, ATPase, rpt1 K.IATEK#DFLEAVNK.V P62193 Proteasome 26S subunit, ATPase, rpt2 K.K#QEGTPEGLYL.P62193 Proteasome 26S subunit, ATPase, rpt2 R.SK#VDDLR.G Q63570 Proteasome 26S subunit, ATPase, rpt3 R.VVGSEFVQK#YLGEGPR.M Q63569 Proteasome 26S subunit, ATPase, rpt5 R.DAFALAK#EK.A Q63569 Proteasome 26S subunit, ATPase, rpt5 K.LK#PGDLVGVNK.D Q63569 Proteasome 26S subunit, ATPase, rpt5 R.LLDSEIK#IMK.S G3V7Q6 Proteasome 26S subunit, beta type R.ATAGAYIASQTVK#K.V Q9JMB5 Proteasome 26S subunit, rpn13 K.MSLK#GTTVTPDK.R Q9JMB5 Proteasome 26S subunit, rpn13 K.M%SLK#GTTVTPDK.R Q9JMB5 Proteasome 26S subunit, rpn13 R.GSSTK#YLVEFR.A D4AEH3 Proteasome 26S subunit, rpn8 R.DIK#DTTVGTLSQR.I B0BN93 Proteasome 26S subunit, rpn9 R.FYDLSSK#YYQTIGNHASYYK.D B0BN93 Proteasome 26S subunit, rpn9 K.TAIGALK#LNIGDLQATK.E E9PTI4 Protein Abca3 R.TVVGKEEEGGDPEK#AFR.T E9PTI4 Protein Abca3 K.EEEGGDPEK#AFR.T E9PTI4 Protein Abca3 R.TVVGK#EEEGGDPEK#AFR.T E9PTI4 Protein Abca3 R.SEGK#QEVLEEFK.A E9PTI4 Protein Abca3 K.VRSEGK#QEVLEEFK.A E9PTI4 Protein Abca3 R.TVVGK#EEEGGDPEK.A D4A0E8 Protein arginine N-methyltransferase 5 (Predicted), isK.LSPWIHPDSK#VEK.I F1LT32 Protein Birc6 K.GSSYK#LLVEQAK.L F1LT32 Protein Birc6 K.AVDSTLK#TR.I F1LT32 Protein Birc6 K.FLDSGPNK#AVDSTLK.T D3ZA14 Protein Efr3a K.ADMEK#LTFYAVSAPEK.L D3ZA14 Protein Efr3a K.LTFYAVSAPEK#LDR.I D3ZA14 Protein Efr3a K.ADM%EK#LTFYAVSAPEK.L D3ZA14 Protein Efr3a K.GSVGSVSLSSK#DNDEK. D3ZAY2 Protein Epb4.1l2 K.VAELHK#THR.G D3ZAY2 Protein Epb4.1l2 K.ELEEK#VAELHK.T D3ZAY2 Protein Epb4.1l2 R.GLSPAQADSQFLENAK#R.L D3ZAY2 Protein Epb4.1l2 K.DK#EEEVIQDIQEEK.L D3ZB32 Protein Epb41l3 R.DAENQK#NWLDPAK.E D3ZB32 Protein Epb41l3 K.ELEDK#VIELHK.S D3ZB32 Protein Epb41l3 R.K#PTEFIGGVSSTTQSWVQK.L D3ZBE2 Protein Epb41l3 K.ESRGGVLEPEGTVEIK#FRK.K Q9Z0W5 Protein kinase C and casein kinase substrate in neur K.VSELHQEVK#NSLLNEDLEK.V Protein kinase C beta type K.APEEK#TANTISK.F P68403 P68403 Protein kinase C beta type R.K#GTDELYAVK.I Protein kinase C delta type K.LLAEALNQVTQK#ASR.K P09215 P63319 Protein kinase C gamma type R.SGENFDK#FFTR.A Q9Z250 Protein lin-7 homolog A R.ATAK#ATVAAFAASEGHSHPR.V Protein NDRG2 -.A]ELQEVQITEEK#PLLPGQTPEAAK.E Q8VBU2 Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.YM%VADK#FTELQK.A Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.YMVADK#FTELQK.A Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.AAASK#LGEFAK.V Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub K.FTELQK#AVGPEITK.T Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.RAAASK#LGEFAK.V Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.VSSAVK#AELR.Q Q5XI34 Protein phosphatase 2 (Formerly 2A), regulatory sub R.AAASHK#VK.E K.LLVPAAEGEDSLK#K.M Q91XU1 Protein quaking Q5FVJ0 Protein RUFY3 K.SNTK#LTEELAVANNR. Q5FVJ0 Protein RUFY3 K.DGNSSK#GSEGDGQITAILDQK.N D3Z803 Protein Shisa7 K.LEYSK#LLLAPGSSPK.T Protein Shisa7 K.DLDEAYLK#R.R D3Z823 D3Z823 Protein Shisa7 K.RLAEK#DLDEAYLK.R D3Z823 Protein Shisa7 K.NLYNTMK#PSNLDWR.A E9PTX9 Protein Slc12a2 K.ESK#GPVAPLNVADQK.L Protein Slc12a2 R.DAVVTYTAESK#GVVK.F E9PTX9 E9PTX9 Protein Slc12a2 K.SPGTK#DVVVNVDYSK.K E9PTX9 Protein Slc12a2 K.EGLDISHLQGQEELLSSQEK#SPGTK.D Protein Slc12a2 K.K#ENIVAFDDM%IEPYR.L E9PTX9 E9PTX9 Protein Slc12a2 K.K#ENIVAFDDMIEPYRLHEDDKEQDIADK.M Prr7, Proline-rich protein 7 K.QEQPPPSYK#PLFLDR.G P0C6T3 P31016 PSD-95, disks large homolog 4 R.EVTHSAAVEALK#EAGSIVR.L PSD-95, disks large homolog 4 R.SLENVLEINK#R. P31016 P31016 PSD-95, disks large homolog 4 K.IIEGGAAHK#DGR.L PSD-95, disks large homolog 4 K.MEK#DIQAHK.F P31016 P31016 PSD-95, disks large homolog 4 R.ALFDYDK#TK.D P31016 PSD-95, disks large homolog 4 K.VM%EIK#LIK.G P31016 PSD-95, disks large homolog 4 R.RKPPAEK#VMEIK.L Q8K5B0 P-selectin glycoprotein ligand K.VQDQK#TER.S G3V8P9 Putative uncharacterized protein RGD1310680_pred R.EGMHLK#DVDFR.E G3V8P9 Putative uncharacterized protein RGD1310680_pred R.DVSK#ELVGLADHAATR.L D3ZT16 Putative uncharacterized protein RGD1560102_pred R.QEFQAWTGVK#PSR.S K.QGKAGLQM%K#SPEK.K B5DFG8 Pygopus 2 P11980 Pyruvate kinase isozymes M1/M2 K.GADYLVTEVENGGSLGSK#K.G P11980 Pyruvate kinase isozymes M1/M2 K.K#GVNLPGAAVDLPAVSEK.D K.GATLK#ITLDNAYM%EK.C P11980 Pyruvate kinase isozymes M1/M2 P11980 Pyruvate kinase isozymes M1/M2 K.IYVDDGLISLQVK#EK.G P11980 Pyruvate kinase isozymes M1/M2 K.NIK#IISK.I P50398 Rab GDP dissociation inhibitor alpha R.K#QNDVFGEADQ.P50398 Rab GDP dissociation inhibitor alpha R.NPYYGGESSSITPLEELYK#R.F Rab GDP dissociation inhibitor beta K.YIAIVSTTVETK#EPEK.E P50399 O35550 Rab GTPase-binding effector protein 1 K.QEAIDEVK#R.Q Q62835 Rab GTPase-binding effector protein 2 K.DSISSYETQIAALK#QER.Q RAD23A K.ILSDDIPIK#EYHIDEK.N D4AD39

1.601 1.601 1.601 2.611 2.614 2.614 2.369 2.369 2.55 3.765 3.765 4.713 4.713 4.713 4.713 1.659 1.88 2.212 2.545 2.545 2.545 2.545 3.058 3.058 3.058 3.058 3.058 2.37 2.37 2.37 1.789 2.06 1.524 2.801 2.801 2.801 1.888 2.312 2.717 3.083 2.562 3.778 3.227 3.227 2.18 2.18 2.18 1.98 1.98 1.965 1.965 2.533 2.349 2.349 2.349 2.627 2.846 2.846 2.846 3.225 2.642 2.642 3.117 3.117 3.117 3.117 3.117 3.117 2.45 2.725 2.725 2.725 2.448 2.448 2.448 2.448 2.005 2.005 2.005 2.005 3.248 3.248 3.248 2.022 5.509 2.465 2.465 3.689 2.783 5.097 4.17 2.594 2.594 2.594 2.594 2.594 2.594 2.594 2.633 3.509 3.509 4.055 2.812 2.812 2.812 2.974 2.974 2.974 2.974 2.974 2.974 3.766 2.044 2.044 2.044 2.044 2.044 2.044 2.044 1.825 2.263 2.263 3.261 1.739 1.988 1.988 1.988 1.988 1.988 2.561 2.561 2.407 2.12 3.6 1.98

0.083 0.083 0.083 0.584 0.503 0.503 0.175 0.175 0.312 0.749 0.749 0.505 0.505 0.505 0.505 0.243 0.139 0.312 0.424 0.424 0.424 0.424 0.492 0.492 0.492 0.492 0.492 0.587 0.587 0.587 0.044 0.204 0.48 0.091 0.091 0.091 0.584 0.492 0.253 0.25 0.261 0.587 0.47 0.47 0.052 0.052 0.052 0.438 0.438 0.213 0.213 0.666 0.133 0.133 0.133 0.099 0.226 0.226 0.226 0.425 0.622 0.622 0.455 0.455 0.455 0.455 0.455 0.455 0.291 0.311 0.311 0.311 0.185 0.185 0.185 0.185 0.206 0.206 0.206 0.206 0.638 0.638 0.638 0.191 0.371 0.309 0.309 0.673 0.636 0.762 0.39 0.323 0.323 0.323 0.323 0.323 0.323 0.323 0.039 0.209 0.209 0.623 0.54 0.54 0.54 0.599 0.599 0.599 0.599 0.599 0.599 0.679 0.254 0.254 0.254 0.254 0.254 0.254 0.254 0.267 0.569 0.569 0.458 0.074 0.064 0.064 0.064 0.064 0.064 0.66 0.66 0.218 0.285 0.679 0.444

2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 2 2 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 2 3 3 3 2 2 2 2 3 3 3 3 3 3 3 4 3 2 2 3 3 3 3 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3

538.7919 538.7919 538.7919 619.3326 661.6761 661.6761 630.3517 630.3517 438.5539 676.3669 676.3669 821.3929 821.3929 821.3929 821.3929 560.782 989.4531 516.787 607.6546 607.6546 607.6546 607.6546 597.3213 597.3213 597.3213 597.3213 597.3213 598.644 598.644 598.644 493.5858 594.8227 477.5724 650.3199 650.3199 650.3199 764.0666 676.3284 519.2847 658.657 647.3247 585.6745 782.7332 782.7332 627.9903 627.9903 627.9903 531.283 531.283 473.7505 473.7505 626.9962 435.2483 435.2483 435.2483 508.2787 467.5772 467.5772 467.5772 774.4051 614.353 614.353 529.9207 529.9207 529.9207 529.9207 529.9207 529.9207 825.4349 569.2968 569.2968 569.2968 861.9114 861.9114 861.9114 861.9114 402.2231 402.2231 402.2231 402.2231 732.0415 732.0415 732.0415 562.0551 780.0688 619.3254 619.3254 585.9952 487.8973 698.6866 925.8137 463.2646 463.2646 463.2646 463.2646 463.2646 463.2646 463.2646 528.6247 745.3564 745.3564 572.9884 622.637 622.637 622.637 657.3134 657.3134 657.3134 657.3134 657.3134 657.3134 643.6665 552.3282 552.3282 552.3282 552.3282 552.3282 552.3282 552.3282 559.2841 730.8513 730.8513 824.4163 766.3954 612.0026 612.0026 612.0026 612.0026 612.0026 806.3912 806.3912 641.3416 401.2105 685.0098 459.5926


1 1 1 1 14 1 1 1 2 7 1 4 2 2 1 1 1 2 13 5 1 1 9 3 2 1 1 4 2 2 1 1 1 2 1 1 1 1 10 1 1 4 15 7 9 5 1 6 1 2 1 1 7 2 1 9 6 4 1 2 6 2 7 4 3 2 2 1 5 7 3 1 5 4 3 1 1 1 1 1 4 4 1 1 1 4 2 2 2 1 4 34 26 15 10 8 2 1 3 4 1 3 4 4 3 4 4 2 2 1 1 5 14 9 5 3 2 1 1 1 1 1 3 1 10 3 2 1 1 2 1 1 2 8 2

16 16 16 1 15 15 2 2 2 8 8 9 9 9 9 1 1 2 20 20 20 20 16 16 16 16 16 8 8 8 1 1 1 4 4 4 1 1 10 1 1 4 22 22 15 15 15 7 7 3 3 1 10 10 10 9 11 11 11 2 8 8 19 19 19 19 19 19 5 11 11 11 13 13 13 13 4 4 4 4 9 9 9 1 1 6 6 2 2 1 4 96 96 96 96 96 96 96 3 5 5 3 11 11 11 14 14 14 14 14 14 5 35 35 35 35 35 35 35 1 2 2 3 1 17 17 17 17 17 3 3 1 2 8 3

K589 K589 K66 K424 K596 K97 K150 K160 K185 K992 K151 K1401 K1609 K1607 K789 K87 K59 K380 K60 K233 K61 K60 K20 K20 K14 K20 K20 K4466 K4466 K3353 K1241 K373 K40 K571 K571 K571 K63 K208 K506 K438 K33 K115 K70 K70 K102 K102 K171 K110 K407 K430 K98 K238 K276 K146 K53 K91 K34 K34 K21 K180 K161 K122 K510 K510 K501,K510 K1618 K1618 K501 K95 K1206 K2082 K2075 K39 K50 K39 K369 K375 K369 K394 K167 K165 K269 K651 K2232 K99 K320 K362 K297 K645 K91 K13 K266 K266 K188 K272 K188 K163 K305 K190 K294 K249 K291 K339 K331 K274 K986 K271 K939 K934 K1089 K1089 K197 K138 K663 K202 K591 K441 K162 K157 K401 K262 K205 K137 K39 K206 K207 K141 K186 K266 K437 K54 K360 K107 K92 K62


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

D4AD39 RAD23A K.TLQQQTFK#IR.M Q4KMA2 RAD23B K.LIYAGK#ILSDDTALK.E Q4KMA2 RAD23B K.NFVVVMVTK#PK.A Q4KMA2 RAD23B K.IDIDPEETVK#ALK.E Q4KMA2 RAD23B K.ILSDDTALK#EYK.I Q4KMA2 RAD23B R.DAFPVAGQK#LIYAGK.I Q4KMA2 RAD23B K.GK#DAFPVAGQK.L Q4KMA2 RAD23B K.IDEK#NFVVVMVTKPK.A Q4KMA2 RAD23B K.NFVVVM%VTK#PK.A Q6P791 Ragulator complex protein LAMTOR1 R.K#LLLDPSNTPTK.A Q6P791 Ragulator complex protein LAMTOR1 K.LLLDPSNTPTK#ALNGAEPSYHSLPSAR.T Q9QUH6 Ras GTPase-activating protein SynGAP K.DSQIK#SIIGR.L Q9QUH6 Ras GTPase-activating protein SynGAP K.EK#PPPPPPGGGK.D Q9QUH6 Ras GTPase-activating protein SynGAP K.M%LSVNK#SVSMLDLQGDGPGGR.L Q9QUH6 Ras GTPase-activating protein SynGAP K.EGSIGGSGGSGGGGGGGLK#PSITK.Q Q9QUH6 Ras GTPase-activating protein SynGAP K.MLSVNK#SVSMLDLQGDGPGGR.L Q9QUH6 Ras GTPase-activating protein SynGAP R.VK#EYEEEIHSLK.E Q9QUH6 Ras GTPase-activating protein SynGAP K.M%LSVNK#SVSM%LDLQGDGPGGR.L Ras GTPase-activating protein SynGAP R.LLSQEEQTSK#ILMQYQAR.L Q9QUH6 Q9QUH6 Ras GTPase-activating protein SynGAP R.LPSPTK#EKPPPPPPGGGK.D Q9QUH6 Ras GTPase-activating protein SynGAP R.DHPAMAEPLPEPK#K.R Q9QUH6 Ras GTPase-activating protein SynGAP K.MLSVNK#SVSM%LDLQGDGPGGR.L R.LK#EQGQAPITPQQGQALAK.Q Q32PX6 Ras homolog gene family, member G Q32PX6 Ras homolog gene family, member G K.EQGQAPITPQQGQALAK#QIHAVR.Y Q6RUV5 Ras-related C3 botulinum toxin substrate 1 K.K#LTPITYPQGLAM%AK.E Q6RUV5 Ras-related C3 botulinum toxin substrate 1 R.GLK#TVFDEAIR.A Q6RUV5 Ras-related C3 botulinum toxin substrate 1 K.LDLRDDK#DTIEK.L Q6RUV5 Ras-related C3 botulinum toxin substrate 1 K.LDLRDDKDTIEK#LK.E P61107 Ras-related protein Rab-14 K.TGENVEDAFLEAAK#K. P61107 Ras-related protein Rab-14 K.IYQNIQDGSLDLNAAESGVQHK#PSAPQGGR.L P10536 Ras-related protein Rab-1B R.YASENVNK#LLVGNK.C P62824 Ras-related protein Rab-3C K.MSESLETDPAITAAK#QSTR.L P62824 Ras-related protein Rab-3C K.DNINVK#QTFER.L P62824 Ras-related protein Rab-3C K.M%SESLETDPAITAAK#QSTR.L Q9WVB1 Ras-related protein Rab-6A K.AK#ELNVMFIETSAK.A Q9WVB1 Ras-related protein Rab-6A K.TDLADK#R.Q P70550 Ras-related protein Rab-8B K.ERGEK#LAIDYGIK.F P63322 Ras-related protein Ral-A R.ADQWNVNYVETSAK#TR.A P63322 Ras-related protein Ral-A K.RQVSVEEAK#NR.A P63322 Ras-related protein Ral-A K.NRADQWNVNYVETSAK#TR.A P36860 Ras-related protein Ral-B K.AEEWGVQYVETSAK#TR.A Ras-specific guanine nucleotide-releasing factor 1 K.TVAK#QLR.Q P28818 P28818 Ras-specific guanine nucleotide-releasing factor 1 R.IQSNQLVAPEDEDSDIK#K.I K.GFFEGSIASK#GK.G G3V6T1 RCG20221, isoform CRA_b G3V6T1 RCG20221, isoform CRA_b R.QELILSNSEDK#SIR.V K.ELTSLVK#EVYPEAR.K G3V7F6 RCG23529, isoform CRA_a D3Z8Q5 RCG25747 K.NLIPQGIVK#LDPPR.I A2RRU2 RCG26229, isoform CRA_a R.SPGSSALPK#QPER.S G3V8H3 RCG28672, isoform CRA_a K.IYSEFLGK#RPWFAGDK.V D3ZYW5 RCG32037 K.LATLLIHQK#K.H B0BNK1 RCG32615, isoform CRA_a K.NWVK#ELQR.Q G3V8Y0 RCG32756 R.EMSSK#TIPELLK.W D4A3T3 RCG35120, isoform CRA_a K.NSDEADLVPAK#EANVK.C G3V8Q8 RCG40648, isoform CRA_b R.MGSDLK#QGFISSLK.S G3V8Q8 RCG40648, isoform CRA_b K.IVESPEFSK#DEDYLGK.V D3ZHC6 RCG43690, isoform CRA_a R.AVSPVMALGK#DTKSSLPPLLK.D3ZU08 RCG46917, isoform CRA_c -.A]AQK#INEGLEHLAK.A D3ZU08 RCG46917, isoform CRA_c K.LGLSLVVPGGGIK#K.K G3V8K2 RCG47413 R.K#MVEQLK.I G3V8K2 RCG47413 -.MK#GETPVNSTMSIGQAR.K G3V8K2 RCG47413 -.M]K#GETPVNSTMSIGQAR.K D3ZVC0 RCG49687, isoform CRA_c R.SK#EQLNSYT.D3ZVC0 RCG49687, isoform CRA_c K.AK#EEQELQDIQSR.S D3ZVC0 RCG49687, isoform CRA_c K.MQAYQDIK#AK.E D3ZVC0 RCG49687, isoform CRA_c K.M%QAYQDIK#AK.E D3ZVC0 RCG49687, isoform CRA_c K.DASK#MQAYQDIK.A D3ZVC0 RCG49687, isoform CRA_c K.DASK#M%QAYQDIK.A D3ZVC0 RCG49687, isoform CRA_c -.M]K#PAMETAAEENTEQSQER.K D3ZVC0 RCG49687, isoform CRA_c K.MQAYQDIK#AKEEQELQDIQSR.S D3ZVC0 RCG49687, isoform CRA_c K.M%QAYQDIK#AKEEQELQDIQSR.S D3ZTP3 RCG50292, isoform CRA_a R.SQTEEHEEAGPLPTK#VNLAHSEI. G3V7G8 RCG52516 R.YPLFEGQETGKK#ETVEE.G3V7G8 RCG52516 K.TSGHVDK#FADFMVK.D G3V7G8 RCG52516 R.AVAELK#AR.K G3V7G8 RCG52516 K.TSGHVDK#FADFM%VK.D G3V7G8 RCG52516 R.IYLYLTK#VGISPDK.L G3V7G8 RCG52516 R.VLEAK#ELALQPK.D G3V7G8 RCG52516 R.YPLFEGQETGK#KETVEE.D4A133 RCG52629 K.ITLEVAK#LIK.D D4A133 RCG52629 K.WEFIPSK#NLR.V D4A133 RCG52629 K.LIK#DDFLQQNGYTPYDR.F D4A133 RCG52629 K.DGEAK#IK.A D4A133 RCG52629 -.M]DFSK#LPK.I D3ZTD8 RCG53309 K.YDSVEAIK#AFNK.N D3ZZY4 RCG54790, isoform CRA_c R.IEGLAPK#LDPEEMK.R RCG55152, isoform CRA_a K.VQVALGNIASK#R.E D4A1B8 D4AC23 RCG55994, isoform CRA_c R.GK#ATISNDGATILK.L RCG56448, isoform CRA_a R.EYIEIITSSIK#K.I D3ZUP5 D3ZUP5 RCG56448, isoform CRA_a R.VTK#GETLT.G3V6W6 RCG61291 K.VVSSSIVDK#YIGESAR.L G3V6W6 RCG61291 K.LLEHK#EIDGR.L D4A0U9 RCG61559 R.AIM%YEETTYSK#K.K Q62799 Receptor tyrosine-protein kinase erbB-3 R.GESIEPLDPSEK#ANK.V Q62799 Receptor tyrosine-protein kinase erbB-3 R.LAEIPDLLEK#GER.L Receptor-type tyrosine-protein phosphatase C R.TFRDVVVTINDHK#R.C P04157 P04157 Receptor-type tyrosine-protein phosphatase C R.DVVVTINDHK#R.C P58751 Reelin K.GWK#RITYPLPESLM%GNPVR.F D4AD40 Regulator of chromosome condensation (RCC1) and K.EFIAK#ASK.C Regulator of chromosome condensation (RCC1) and K.NNLLSPTQIMVEK#ER.V D4AD40 P49803 Regulator of G-protein signaling 7 R.MRNPHK#TRK.S NP_001128457.1 REST corepressor 3 R.IQQM%LPDK#TIASLVK#YYYSWK.K B2GUZ6 Reticulon 4 interacting protein 1 K.RDPLHM%K#TK#GEEFPLTLGR.D K.DVFEAFYK#K.D B2RYJ3 RGD1563853 protein Q5XI73 Rho GDP-dissociation inhibitor 1 K.IDK#TDYM%VGSYGPR.A Q5XI73 Rho GDP-dissociation inhibitor 1 K.IDK#TDYMVGSYGPR.A D3ZMS4 Rho GTPase activating protein 26 (Predicted) K.TVTSALK#TYLR.M Rho-related GTP-binding protein RhoB R.MK#QEPVRTDDGR.A P62747 P60892 Ribose-phosphate pyrophosphokinase 1 R.MVLVGDVK#DR.V P60892 Ribose-phosphate pyrophosphokinase 1 K.IFSGSSHQDLSQK#IADR.L R.SLEAK#AVSVR.T Q9JIR1 RIMS-binding protein 2 Q9JIR1 RIMS-binding protein 2 R.VQSEQFNLLSRDLEK#FR.Q R.VAELNDVTAK#IAAGQEK.H Q6IV57 RING finger protein 141 Q6AY30 Saccharopine dehydrogenase-like oxidoreductase R.SVSNLK#PVPVIGSK.L Q6AY30 Saccharopine dehydrogenase-like oxidoreductase K.YHEK#AAEK.G Q62936 SAP-102, disks large homolog 3 K.IIEGGAAQK#DGR.L R.QVTPDGESDEVGVIPSK#RRVEK.K Q62696 SAP-97, disks large homolog 1 Q99MS0 SEC14-like protein 2 R.VGDLSPK#QEEALAK.F Q99MS0 SEC14-like protein 2 R.DQVK#QQYEHSVQISR.G P56603 Secretory carrier-associated membrane protein 1 R.TTGASFEK#AQQEFATGVM%SNK.T P56603 Secretory carrier-associated membrane protein 1 R.TTGASFEK#AQQEFATGVMSNK.T Secretory carrier-associated membrane protein 1 K.EHALAQAELLK#R.Q P56603 P56603 Secretory carrier-associated membrane protein 1 K.TVQTAAANAASTAATSAAQNAFK#GNQM. Q9JKE3 Secretory carrier-associated membrane protein 5 -.A]EK#VNNFPPLPK.F R.GSGGSFSK#AQEEWTTGAWK.N Q9JKE3 Secretory carrier-associated membrane protein 5 D3ZDH8 Septin 5, isoform CRA_d K.ESAPFAVIGSNTVVEAK#GQR.V D3ZDH8 Septin 5, isoform CRA_d R.MK#DEELRR.M Septin 5, isoform CRA_d K.MK#QQMQDQ.D3ZDH8 D3ZDH8 Septin 5, isoform CRA_d K.ALHEK#VNIVPLIAK.A D3ZDH8 Septin 5, isoform CRA_d K.HTVDIEEK#GVK.L B3GNI6 Septin-11 K.KLDSK#VNIIPIIAK.S B3GNI6 Septin-11 K.DTDPDSK#PFSLQETYEAK.R Septin-11 K.LDSK#VNIIPIIAK.S B3GNI6 B3GNI6 Septin-11 K.RNEFLGELQK#K.E B3GNI6 Septin-11 K.KK#ELEEEVSNFQK.K Septin-7 K.QIMK#EIQEHK.I D4A0F5

1.98 3.435 3.435 3.435 3.435 3.435 3.435 3.435 3.435 3.582 3.582 2.221 2.221 2.221 2.221 2.221 2.221 2.221 2.221 2.221 2.221 2.221 2.633 2.633 2.392 2.392 2.392 2.392 4.004 4.004 2.64 3.285 3.285 3.285 1.996 1.996 2.172 3.724 3.724 3.724 2.337 1.873 1.873 2.038 2.038 2.458 2.358 3.713 3.217 1.879 2.097 1.968 2.984 3.361 3.361 2.238 2.556 2.556 3.077 3.077 3.077 4.325 4.325 4.325 4.325 4.325 4.325 4.325 4.325 4.325 3.505 3.424 3.424 3.424 3.424 3.424 3.424 3.424 2.413 2.413 2.413 2.413 2.413 3.447 1.876 2.81 2.769 1.508 1.508 2.861 2.861 2.066 2.294 2.294 2.696 2.696 2.672 2.375 2.375 2.495 2.704 2.49 2.22 3.235 3.235 2.708 2.387 2.799 2.799 2.334 2.334 2.335 2.058 2.058 2.572 2.92 2.444 2.444 2.767 2.767 2.767 2.767 4.743 4.743 1.965 1.965 1.965 1.965 1.965 2.612 2.612 2.612 2.612 2.612 2.525

0.444 0.072 0.072 0.072 0.072 0.072 0.072 0.072 0.072 0.443 0.443 0.071 0.071 0.071 0.071 0.071 0.071 0.071 0.071 0.071 0.071 0.071 0.265 0.265 0.19 0.19 0.19 0.19 0.04 0.04 0.338 0.758 0.758 0.758 0.189 0.189 0.194 0.498 0.498 0.498 0.183 0.212 0.212 0.047 0.047 0.197 0.565 0.509 0.369 0.1 0.232 0.567 0.189 0.585 0.585 0.046 0.053 0.053 0.482 0.482 0.482 0.641 0.641 0.641 0.641 0.641 0.641 0.641 0.641 0.641 0.465 0.692 0.692 0.692 0.692 0.692 0.692 0.692 0.239 0.239 0.239 0.239 0.239 0.321 0.015 0.457 0.258 0.422 0.422 0.335 0.335 0.195 0.078 0.078 0.284 0.284 0.012 0.154 0.154 0.151 0.116 0.077 0.207 0.372 0.372 0.61 0.323 0.256 0.256 0.183 0.183 0.221 0.225 0.225 0.689 0.088 0.189 0.189 0.295 0.295 0.295 0.295 0.485 0.485 0.257 0.257 0.257 0.257 0.257 0.032 0.032 0.032 0.032 0.032 0.346

3 2 2 2 2 2 2 2 2 4 4 3 3 3 3 3 3 3 3 3 3 3 4 4 3 3 3 3 2 2 3 3 3 3 2 2 3 3 3 3 3 2 2 2 2 3 3 3 3 3 2 2 3 3 3 4 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 3 3 3 2 2 3 3 3 2 2 4 4 4 3 3 3 3 4 2 3 3 3 3 3 3 2 2 3 2 2 2 4 3 3 4 4 4 4 3 3 3 3 3 3 3 3 3 3 3 3 3

459.5926 696.3895 696.3895 696.3895 696.3895 696.3895 696.3895 696.3895 696.3895 741.6362 741.6362 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 760.7272 646.5992 646.5992 525.6052 525.6052 525.6052 525.6052 868.4271 868.4271 554.965 722.681 722.681 722.681 466.7424 466.7424 535.9576 477.2542 477.2542 477.2542 656.6528 465.2805 465.2805 671.3428 671.3428 583.3126 558.6613 489.9229 676.6827 426.9348 593.8188 745.4006 605.3022 542.2847 542.2847 567.3277 484.6363 484.6363 654.9827 654.9827 654.9827 779.3406 779.3406 779.3406 779.3406 779.3406 779.3406 779.3406 779.3406 779.3406 877.428 700.0026 700.0026 700.0026 700.0026 700.0026 700.0026 700.0026 437.7354 437.7354 437.7354 437.7354 437.7354 749.8803 561.9593 457.2686 501.6108 481.763 481.763 441.9047 441.9047 531.9199 864.4263 864.4263 454.2466 454.2466 586.8114 629.3304 629.3304 427.9032 940.4866 618.0711 630.8165 572.6061 572.6061 456.2612 515.9188 668.3354 668.3354 587.3324 587.3324 624.3341 545.2702 545.2702 664.8487 635.583 653.6609 653.6609 678.3273 678.3273 678.3273 678.3273 709.9951 709.9951 397.5358 397.5358 397.5358 397.5358 397.5358 513.3141 513.3141 513.3141 513.3141 513.3141 466.5774


Page 42 of 60 1 28 10 8 5 4 3 2 1 9 1 17 6 5 5 4 3 2 1 1 1 1 2 1 9 3 1 1 1 1 18 9 6 2 3 1 3 2 1 1 2 1 1 1 1 3 3 3 1 1 2 1 1 2 2 1 2 1 2 2 1 21 16 5 4 3 2 1 1 1 14 9 6 3 3 2 2 1 12 4 4 1 1 1 1 1 2 6 1 3 1 1 1 1 1 1 1 2 1 1 1 1 1 4 3 2 1 7 3 1 1 1 2 1 5 1 2 1 6 6 3 1 8 2 2 1 1 1 1 6 2 1 1 1 1

3 61 61 61 61 61 61 61 61 10 10 46 46 46 46 46 46 46 46 46 46 46 3 3 14 14 14 14 2 2 18 17 17 17 4 4 3 4 4 4 2 2 2 2 2 3 3 3 1 1 2 1 1 4 4 1 3 3 5 5 5 54 54 54 54 54 54 54 54 54 14 26 26 26 26 26 26 26 22 22 22 22 22 1 1 1 2 7 7 4 4 1 2 2 2 2 1 3 3 1 1 1 1 7 7 2 1 10 10 2 2 1 3 3 5 1 3 3 16 16 16 16 10 10 6 6 6 6 6 11 11 11 11 11 14

K16 K51 K76 K24 K60 K45 K36 K67 K76 K20 K31 K1260 K793 K839 K1130 K839 K1196 K839 K1232 K791 K1288 K839 K130 K147 K133 K166 K123 K128 K170 K193 K116 K209 K181 K209 K146 K133 K138 K159 K143 K159 K160 K158 K204 K825 K271 K93 K93 K25 K144 K568 K117 K29 K150 K870 K930 K170 K5 K281 K18 K2 K2 K321 K308 K306 K306 K298 K298 K2 K306 K306 K315 K723 K186 K88 K186 K408 K97 K722 K513 K139 K516 K596 K5 K1035 K10 K50 K55 K30 K70 K220 K34 K852 K693 K924 K756 K756 K2819 K522 K283 K225 K174,K181 K109,K111 K454 K141 K141 K454 K135 K212 K18 K557 K60 K51 K220 K140 K286 K643 K11 K275 K298 K298 K89 K334 K4 K185 K265 K357 K372 K190 K107 K175 K315 K175 K336 K386 K193

Page 43 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


D4A0F5 Septin-7 K.K#NLEAQHK.E D4A0F5 Septin-7 K.GQLTK#SPLAQMEEERR.E D4A0F5 Septin-7 K.NLEAQHK#ELEEK.R D4A0F5 Septin-7 K.IYEFPETDDEEENK#LVK.K D4A0F5 Septin-7 R.HEQMK#K.N B0BNF1 Septin-8 K.RK#EFLSELQR.K Q9QZR6 Septin-9 K.SITHDIEEK#GVR.M Q64303 Serine/threonine-protein kinase PAK 2 R.DIK#SDNVLLGMEGSVK.L P62716 Serine/threonine-protein phosphatase 2A catalytic suR.IGGK#SPDTNYLFMGDYVDR.G P62716 Serine/threonine-protein phosphatase 2A catalytic suK.EILTK#ESNVQEVR.C P63329 Serine/threonine-protein phosphatase 2B catalytic suR.LTAK#EVFDNDGKPR.V P62138 Serine/threonine-protein phosphatase PP1-alpha cataR.LLEVQGSRPGK#NVQLTENEIR.G B2RYI2 Signal recognition particle 68 R.VLK#YASEVSSHGGAFK.N D4A511 Signal recognition particle 9 kDa protein R.AAEK#LYLADPMK.V D3ZZM9 Similar to 1700054N08Rik protein (Predicted) R.VK#PSSAENPWLTEYMR.C D3ZZM9 Similar to 1700054N08Rik protein (Predicted) R.GAELRDTEEQDTVLPAPPK#K.D D3ZZM9 Similar to 1700054N08Rik protein (Predicted) R.AHSVDVEK#NQR.V D4A7T8 Similar to 6430514L14Rik protein (Predicted) K.IK#DAEGQISQLLNR.V Similar to 6430514L14Rik protein (Predicted) K.TTYEGLQHLNK#EQQAAK.L D4A7T8 D3ZPP2 Similar to ADP-ribosylation factor-like 10B (Predicted R.DLAGALDEK#ELIEK.M G3V624 Similar to Coronin, actin binding protein 1C (PredictedK.LEQQLAK#M%AA.G3V624 Similar to Coronin, actin binding protein 1C (PredictedK.LEQQLAK#MAA.D3ZJR1 Similar to Epidermal growth factor receptor substrate K.DPFAPSSSAK#PPK.A D3ZQN3 Similar to KIAA1183 protein (Predicted) R.ARTGSK#GLAPAGATAVSTGSR.A D3ZQN3 Similar to KIAA1183 protein (Predicted) K.K#AGSGASTEDHAGNNK.K D3Z8A4 Similar to mKIAA0738 protein (Predicted), isoform CRR.MYLSK#GPNVK.N D3Z8A4 Similar to mKIAA0738 protein (Predicted), isoform CRR.M%YLSK#GPNVK.N NP_001041512.1 similar to receptor expression enhancing protein 2 K.GQGVLSEK#LR.S G3V716 Similar to Regulator of G-protein signaling 20 (RGS20K.DLLK#SLAEK.A G3V716 Similar to Regulator of G-protein signaling 20 (RGS20K.SLAEK#AVEA.D3ZJ01 Similar to RIKEN cDNA 2310035C23 (Predicted) K.IFTNTK#VKPQFQEILR.L D3Z8K9 Similar to RNA-binding protein isoform G3BP-2a, isofR.K#FM%QTFVLAPEGSVPNK.F D3Z8K9 Similar to RNA-binding protein isoform G3BP-2a, isofR.QYYTLLNK#APEYLHR.F D3Z8K9 Similar to RNA-binding protein isoform G3BP-2a, isofR.K#FMQTFVLAPEGSVPNK.F D4A3L0 Similar to suppressor of hairy wing homolog 4 isoformR.EPGASHSESK#QDK.A B0BNE3 Similar to trafficking protein particle complex 5 (Predi R.GK#SALLER.A D3ZQJ8 Similar to transmembrane serine protease 9 (PredicteR.LLVQALK#AFR.S O70593 Small glutamine-rich tetratricopeptide repeat-containi R.AIGIDPGYSK#AYGR.M O70593 Small glutamine-rich tetratricopeptide repeat-containi K.SNLK#IAELK.L Q80W98 Small glutamine-rich tetratricopeptide repeat-containi K.SNLK#IAEQK.L P60881 SNAP25 R.M%LQLVEESK#DAGIR.T R.MLQLVEESK#DAGIR.T P60881 SNAP25 P60881 SNAP25 R.IEEGMDQINK#DMK.E K.K#AWGNNQDGVVASQPAR.V P60881 SNAP25 P60881 SNAP25 K.DMK#EAEK.N K.K#AWGNNQDGVVASQPARVVDER.E P60881 SNAP25 P60881 SNAP25 R.IEEGMDQINK#DM%K.E P60881 SNAP25 K.EAEK#NLTDLGK.F P60881 SNAP25 R.IEEGM%DQINK#DMK.E P23978 Sodium- and chloride-dependent GABA transporter 1K.VADGQISTEVSEAPVASDKPK#TLVVK.V P23978 Sodium- and chloride-dependent GABA transporter 1K.TLVVK#VQK.K P23978 Sodium- and chloride-dependent GABA transporter 1R.LQVMIQPSEDIVRPENGPEQPQAGSSASK#EAYI P23978 Sodium- and chloride-dependent GABA transporter 1-.A]TDNSK#VADGQISTEVSEAPVASDKPK.T P23978 Sodium- and chloride-dependent GABA transporter 1K.K#AGDLPDRDTWK.G P23978 Sodium- and chloride-dependent GABA transporter 1R.LQVM%IQPSEDIVRPENGPEQPQAGSSASK#EAY P31647 Sodium- and chloride-dependent GABA transporter 3K.GDGTISAITEK#ETHF.P31647 Sodium- and chloride-dependent GABA transporter 3K.VK#GDGTISAITEK.E P31647 Sodium- and chloride-dependent GABA transporter 3K.LQK#LTVPSADLK.M P31647 Sodium- and chloride-dependent GABA transporter 3K.LTVPSADLK#M%R.G P31647 Sodium- and chloride-dependent GABA transporter 3K.VKGDGTISAITEK#ETHF.P28572 Sodium- and chloride-dependent glycine transporter K.NATK#PSRDWGPALLEHR.T P04774 Sodium channel protein type 1 subunit alph K.K#QQEAAQQAAAATASEHSR.E P04775 Sodium channel protein type 2 subunit alph K.K#QQEEAQAAAAAASAESR.D P04775 Sodium channel protein type 2 subunit alph K.EDIITDK#LNENSTPEK.T P04775 Sodium channel protein type 2 subunit alph K.GKEDEGTPIK#EDIITDK.L P04775 Sodium channel protein type 2 subunit alph K.ALDEIK#PLEDLNNK.K P04775 Sodium channel protein type 2 subunit alph K.GK#EDEGTPIKEDIITDK.L P04775 Sodium channel protein type 2 subunit alph K.GK#EDEGTPIK.E P04775 Sodium channel protein type 2 subunit alph K.EDEGTPIK#EDIITDK.L P04775 Sodium channel protein type 2 subunit alph K.DK#GKEDEGTPIKEDIITDK.L P04775 Sodium channel protein type 2 subunit alph K.GIDFVK#R.K P04775 Sodium channel protein type 2 subunit alph K.VSYEPITTTLK#R.K P04775 Sodium channel protein type 2 subunit alph K.QK#ALDEIKPLEDLNNKK.D P04775 Sodium channel protein type 2 subunit alph K.DLNYLK#DGNGTTSGIGSSVEK.Y P04775 Sodium channel protein type 2 subunit alph K.DKGK#EDEGTPIKEDIITDK.L P04775 Sodium channel protein type 2 subunit alph K.GKEDEGTPIKEDIITDK#LNENSTPEK.T P08104 Sodium channel protein type 3 subunit alph K.K#QQEEAQAVAAASAASR.D O88420 Sodium channel protein type 8 subunit alph R.LLPEATTEVEIK#K.K O88420 Sodium channel protein type 8 subunit alph K.AMLEQLK#K.Q P54900 Sodium channel subunit beta-2 K.LSTDDLK#TEEEGKTDGEGNAEDGAK.P54900 Sodium channel subunit beta-2 K.TEEEGK#TDGEGNAEDGAK.P54900 Sodium channel subunit beta-2 K.LSTDDLKTEEEGK#TDGEGNAEDGAK.Q9JK00 Sodium channel subunit beta-3 K.VSK#AEEAAQENASDYLAIPSENK.E Q01728 Sodium/calcium exchanger 1 R.GNVIIPYK#TIEGTAR.G Q01728 Sodium/calcium exchanger 1 R.LVEMSEK#K.A K.TISVK#VIDDEEYEK.N Q01728 Sodium/calcium exchanger 1 Q01728 Sodium/calcium exchanger 1 R.GMIIEHEGDRPASK#TEIEMDGK.V Sodium/calcium exchanger 2 R.K#LTAEEEEAQR.I P48768 P48768 Sodium/calcium exchanger 2 K.TLQVK#IVDDEEYEK.K P48768 Sodium/calcium exchanger 2 K.EITITK#ANGETSVGTVR.I Sodium/calcium exchanger 2 K.NTVDK#LIK.K P48768 O54701 Sodium/potassium/calcium exchanger 2 K.VVK#VTVSEAQAK.A O54701 Sodium/potassium/calcium exchanger 2 K.VTVSEAQAK#ASTAGDKEEPTLPNKPR.L O54701 Sodium/potassium/calcium exchanger 2 K.ASTAGDKEEPTLPNK#PR.L K.LK#YYDTMTEEGR.F O54701 Sodium/potassium/calcium exchanger 2 O54701 Sodium/potassium/calcium exchanger 2 K.VTVSEAQAK#ASTAGDK.E P06685 Sodium/potassium-transporting ATPase subunit alph R.AVFQANQENLPILK#R.A P06685 Sodium/potassium-transporting ATPase subunit alph K.K#ADIGVAMGIVGSDVSK.Q Sodium/potassium-transporting ATPase subunit alph K.K#EVSM%DDHK.L P06685 P06685 Sodium/potassium-transporting ATPase subunit alph K.K#EVSMDDHK.L P06685 Sodium/potassium-transporting ATPase subunit alph K.EVSMDDHK#LSLDELHR.K P06685 Sodium/potassium-transporting ATPase subunit alph R.DMDELK#KEVSMDDHK.L Sodium/potassium-transporting ATPase subunit alph R.DK#YEPAAVSEHGDKK.S P06685 P06685 Sodium/potassium-transporting ATPase subunit alph K.EVSM%DDHK#LSLDELHRK.Y P06685 Sodium/potassium-transporting ATPase subunit alph K.YQLSIHK#NPNASEPK.H P06685 Sodium/potassium-transporting ATPase subunit alph K.EVSMDDHK#LSLDELHRK.Y Sodium/potassium-transporting ATPase subunit alph R.GFK#FDTDELNFPTEK.L P06686 P06686 Sodium/potassium-transporting ATPase subunit alph K.YQVDLSK#GLTNQR.A P06686 Sodium/potassium-transporting ATPase subunit alph K.SSK#IMDSFK.N Sodium/potassium-transporting ATPase subunit alph R.AVFK#AGQENISVSK.R P06686 P06686 Sodium/potassium-transporting ATPase subunit alph K.AGQENISVSK#R.D Sodium/potassium-transporting ATPase subunit alph R.KYQVDLSK#GLTNQR.A P06686 P06686 Sodium/potassium-transporting ATPase subunit alph K.K#EVAMDDHK.L Sodium/potassium-transporting ATPase subunit alph R.NSQTDK#LVNER.L P06686 P06686 Sodium/potassium-transporting ATPase subunit alph K.SSK#IM%DSFK.N Sodium/potassium-transporting ATPase subunit alph R.RYPGGWVEK#ETYY.P06686 P06686 Sodium/potassium-transporting ATPase subunit alph K.EVAMDDHK#LSLDELGR.K P06686 Sodium/potassium-transporting ATPase subunit alph K.K#ADIGIAMGISGSDVSK.Q P06686 Sodium/potassium-transporting ATPase subunit alph K.EVAMDDHK#LSLDELGRK.Y P06687 Sodium/potassium-transporting ATPase subunit alph R.AVFK#GGQDNIPVLK.R Sodium/potassium-transporting ATPase subunit alph K.GGQDNIPVLK#R.D P06687 P06687 Sodium/potassium-transporting ATPase subunit alph K.K#EVAM%TEHK.M P06687 Sodium/potassium-transporting ATPase subunit alph K.K#EVAMTEHK.M Sodium/potassium-transporting ATPase subunit alph K.SSK#IMESFK.N P06687 P06687 Sodium/potassium-transporting ATPase subunit alph R.TDK#LVNER.L P06687 Sodium/potassium-transporting ATPase subunit alph K.VIM%VTGDHPITAK#AIAK.S Sodium/potassium-transporting ATPase subunit alph R.QGAIVAVTGDGVNDSPALK#K.A P06687 P06687 Sodium/potassium-transporting ATPase subunit alph K.AIAK#GVGIISEGNETVEDIAAR.L P06687 Sodium/potassium-transporting ATPase subunit alph R.DLDDLKK#EVAMTEHK.M P06687 Sodium/potassium-transporting ATPase subunit alph R.DLDDLKK#EVAM%TEHK.M P06687 Sodium/potassium-transporting ATPase subunit alph R.LIFDNLK#K.S Sodium/potassium-transporting ATPase subunit alph K.IM%ESFK#NM%VPQQALVIR.E P06687 P06687 Sodium/potassium-transporting ATPase subunit alph R.AVFK#GGQDNIPVLKR.D P06687 Sodium/potassium-transporting ATPase subunit alph K.SSK#IM%ESFK.N Sodium/potassium-transporting ATPase subunit alph R.NPGGWVEK#ETYY.P06687

2.525 2.525 2.525 2.525 2.525 2.925 2.805 3.071 2.027 2.027 3.312 3.334 2.225 2.635 3.064 3.064 3.064 2.951 2.951 3.56 2.021 2.021 3.472 2.089 2.089 1.818 1.818 2.311 1.651 1.651 3.221 3.08 3.08 3.08 1.576 2.065 1.544 2.377 2.377 2.358 1.816 1.816 1.816 1.816 1.816 1.816 1.816 1.816 1.816 2.743 2.743 2.743 2.743 2.743 2.743 2.257 2.257 2.257 2.257 2.257 3.96 4.401 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 2.049 3.117 2.214 2.214 3.593 3.593 3.593 3.079 2.361 2.361 2.361 2.361 2.229 2.229 2.229 2.229 2.164 2.164 2.164 2.164 2.164 2.887 2.887 2.887 2.887 2.887 2.887 2.887 2.887 2.887 2.887 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.493 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053 2.053

0.346 0.346 0.346 0.346 0.346 0.236 0.371 0.581 0.208 0.208 0.379 0.663 0.155 0.147 0.404 0.404 0.404 0.133 0.133 0.185 0.358 0.358 0.272 0.199 0.199 0.279 0.279 0.597 0.127 0.127 0.176 0.552 0.552 0.552 0.012 0.28 0.246 0.31 0.31 0.22 0.312 0.312 0.312 0.312 0.312 0.312 0.312 0.312 0.312 0.363 0.363 0.363 0.363 0.363 0.363 0.455 0.455 0.455 0.455 0.455 0.683 0.596 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.388 0.41 0.062 0.062 0.35 0.35 0.35 0.091 0.094 0.094 0.094 0.094 0.125 0.125 0.125 0.125 0.409 0.409 0.409 0.409 0.409 0.583 0.583 0.583 0.583 0.583 0.583 0.583 0.583 0.583 0.583 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.494 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237 0.237

3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 3 3 3 3 2 2 2 3 3 3 3 4 2 3 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 2 2 3 3 3 3 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3

466.5774 466.5774 466.5774 466.5774 466.5774 473.9283 499.9267 606.9803 553.6279 553.6279 568.6282 832.1166 598.6454 488.5903 466.2353 466.2353 466.2353 691.6829 691.6829 553.2904 608.821 608.821 721.8672 677.3601 677.3601 422.8882 422.8882 600.8383 565.8247 565.8247 692.7245 675.0161 675.0161 675.0161 379.1795 494.2829 424.9312 565.3319 565.3319 572.8204 482.7244 482.7244 482.7244 482.7244 482.7244 482.7244 482.7244 482.7244 482.7244 505.9229 505.9229 505.9229 505.9229 505.9229 505.9229 476.28 476.28 476.28 476.28 476.28 688.0221 699.6736 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 474.7679 610.6414 537.8021 537.8021 650.9435 650.9435 650.9435 860.08 539.2844 539.2844 539.2844 539.2844 348.8732 348.8732 348.8732 348.8732 642.3273 642.3273 642.3273 642.3273 642.3273 679.9911 679.9911 679.9911 679.9911 679.9911 679.9911 679.9911 679.9911 679.9911 679.9911 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 881.4141 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972 396.1972


1 1 1 9 1 3 1 1 2 1 10 1 1 1 5 3 2 10 2 5 4 2 12 1 1 4 2 3 1 1 1 3 2 2 1 2 1 9 5 1 36 33 3 3 1 1 1 1 1 8 3 2 2 1 1 14 5 1 1 1 2 3 21 11 8 6 6 2 2 2 1 1 1 1 1 1 4 3 1 6 1 1 1 2 1 1 1 6 5 3 1 10 2 1 1 1 21 7 2 2 1 1 1 1 1 1 30 15 13 10 8 8 6 4 2 1 1 1 1 42 30 11 10 8 4 4 4 4 3 3 2 2 2 1 1

14 14 14 14 14 3 1 1 3 3 10 1 1 1 10 10 10 12 12 5 6 6 12 2 2 6 6 3 2 2 1 7 7 7 1 2 1 14 14 1 80 80 80 80 80 80 80 80 80 17 17 17 17 17 17 22 22 22 22 22 2 3 64 64 64 64 64 64 64 64 64 64 64 64 64 64 4 4 4 8 8 8 1 5 5 5 5 15 15 15 15 15 15 15 15 15 38 38 38 38 38 38 38 38 38 38 100 100 100 100 100 100 100 100 100 100 100 100 100 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133



1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P06687 Sodium/potassium-transporting ATPase subunit alph R.DLDDLK#KEVAM%TEHK.M P06687 Sodium/potassium-transporting ATPase subunit alph K.K#ADIGVAMGIAGSDVSK.Q P07340 Sodium/potassium-transporting ATPase subunit beta K.AK#EEGSWK.K P07340 Sodium/potassium-transporting ATPase subunit beta K.K#FIWNSEK.K P07340 Sodium/potassium-transporting ATPase subunit beta K.AK#EEGSWKK.F Q9JHZ9 Sodium-coupled neutral amino acid transporter 3 K.GFLQQSSSK#EPHFTDFEGK.T P31662 Sodium-dependent neutral amino acid transporter SLK.QSVLNVAGETGGK#QK.V P31662 Sodium-dependent neutral amino acid transporter SLK.NSK#VTQR.E P31662 Sodium-dependent neutral amino acid transporter SLR.FILSK#VPSEAPSPMPTHR.S Q9JJP0 Sodium-dependent phosphate transporter 1 K.DSGLYK#ELLHK.L Q63488 Sodium-dependent phosphate transporter 2 R.K#VQEAESPVFK.E Q63488 Sodium-dependent phosphate transporter 2 K.VQEAESPVFK#ELPGAK.A Q63488 Sodium-dependent phosphate transporter 2 R.ASDTSSAPEDSEK#LVGDTVSYSK.K Q63633 Solute carrier family 12 member 5 K.K#DLTTFLYHLR.I Q63633 Solute carrier family 12 member 5 R.LNEVIVNK#SR.D Q63633 Solute carrier family 12 member 5 R.IFTVAQMDDNSIQMK#K.D Q63633 Solute carrier family 12 member 5 R.IFTVAQM%DDNSIQM%K#K.D Q63633 Solute carrier family 12 member 5 K.ESSPFINSTDTEK#GREYDGR.N K.LQDVAEDK#AK.A Q9Z0Z5 Solute carrier family 13 member 3 P11167 Solute carrier family 2, facilitated glucose transporter R.DLQEMK#EEGR.Q P11167 Solute carrier family 2, facilitated glucose transporter R.QGGASQSDK#TPEELFHPLGADSQV.NP_058798.2 solute carrier family 2, facilitated glucose transporter R.K#EEDQATEILQR.L solute carrier family 2, facilitated glucose transporter R.AFEGQAQSGK#GSAGVELNSMQPVK.E NP_058798.2 NP_058798.2 solute carrier family 2, facilitated glucose transporter K.GSAGVELNSMQPVK#ETPGNA.Q9QZG1 Solute carrier family 22 member 23 K.K#GEQPLLLTNAELK.D Q9EPZ7 Solute carrier organic anion transporter family membeK.SK#FITDDPVNYQMAPR.E Q5U211 Sorting nexin-3 K.VVVPPLPGK#AFLR.Q NP_001099903.1 spartin R.QSSSSGSSIDQGSK#DAR.H NP_001099903.1 spartin R.IQPEEK#PVEVSPAVTR.G NP_001099903.1 spartin K.ELPK#EASGTDVR.Q NP_001099903.1 spartin K.TK#DSSSEEVNLR.Q Q3MHT4 Speckle targeted PIP5K1A-regulated poly(A) polyme R.RSEGARSK#DSPLGGANK.R P16086 Spectrin alpha chain, brain R.EK#LSILSEER.A P16086 Spectrin alpha chain, brain R.ITK#EAGSVSLR.M P16086 Spectrin alpha chain, brain K.EK#LDILDQERTDLEK.A P16086 Spectrin alpha chain, brain K.EK#LDILDQER.T P16086 Spectrin alpha chain, brain K.LQVASDENYK#DPTNLQGK.L P16086 Spectrin alpha chain, brain K.HIQSK#AIEAR.H P16086 Spectrin alpha chain, brain R.IDALEK#AGQK.L P16086 Spectrin alpha chain, brain R.EK#EPIVGSTDYGKDEDSAEALLK.K P16086 Spectrin alpha chain, brain K.K#GDILTLLNSTNK.D Spectrin alpha chain, brain K.ELVLALYDYQEK#SPR.E P16086 G3V6S0 Spectrin beta 2, isoform CRA_a K.ALQFLK#EQR.V K.AK#SALPAQSAATLPAR.T G3V6S0 Spectrin beta 2, isoform CRA_a G3V6S0 Spectrin beta 2, isoform CRA_a K.LSDLQK#EAEK.L K.DAK#SAASGVPYHSEVPVSLK.E G3V6S0 Spectrin beta 2, isoform CRA_a G3V6S0 Spectrin beta 2, isoform CRA_a K.EIEELQSQAQALSQEGK#STDEVDSK.R G3V6S0 Spectrin beta 2, isoform CRA_a R.QLMHSGHPSEK#EIR.A G3V6S0 Spectrin beta 2, isoform CRA_a K.LLEVLSGERLPK#PTK.G G3V6S0 Spectrin beta 2, isoform CRA_a R.FQIQDISVETEDNK#EK.K G3V6S0 Spectrin beta 2, isoform CRA_a R.K#KEIEELQSQAQALSQEGK.S Q6PEC4 S-phase kinase-associated protein 1 K.TFNIK#NDFTEEEEAQVR.K O35049 Sphingomyelin phosphodiesterase 3 K.SPAGGAALLSEWK#GTGAGK.S O35049 Sphingomyelin phosphodiesterase 3 R.EYLAFPTSK#SPGAGQK.G O35049 Sphingomyelin phosphodiesterase 3 R.LEDK#SPAGGAALLSEWK.G O35049 Sphingomyelin phosphodiesterase 3 K.DLLK#GNGR.R O35049 Sphingomyelin phosphodiesterase 3 R.LVASFIPTTYEK#R.Q Q9QXY2 SRC kinase signaling inhibitor 1 R.SLVGFGPPVPAK#DTETR.E Q9QXY2 SRC kinase signaling inhibitor 1 K.SPNTAILIK#DEAR.N B5DF55 Stam1 (SH3 and VHS domains K.ASPALVAK#DPGTVATK.K B5DF55 Stam1 (SH3 and VHS domains K.EQGVTFPAIGSQAAEQAK#ASPALVAK.D B5DF55 Stam1 (SH3 and VHS domains K.DPGTVATK#K.E B5DF55 Stam1 (SH3 and VHS domains K.DPGTVATK#KEEEDLAK.A B5DF55 Stam1 (SH3 and VHS domains K.DPGTVATKK#EEEDLAK.A B5DF55 Stam1 (SH3 and VHS domains K.ASPALVAK#DPGTVATKKEEEDLAK.A D3ZI49 Stathmin R.LAEEK#LNYK.M P13668 Stathmin K.DLSLEEIQK#K.L P13668 Stathmin K.REHEK#EVLQK.A P13668 Stathmin R.EAQMAAK#LER.L D3ZUM2 Sterile alpha and TIR motif containing 1 (Predicted K.TK#VFSDIGAIQSLK.R B4F7D6 Stk11ip protein R.K#LYLEGNPLWFHPAHR.A O35814 Stress-induced-phosphoprotein 1 R.ELIEQLQNK#PSDLGTK.L P09951 Synapsin-1 K.TYATAEPFIDAK#YDVR.V P09951 Synapsin-1 K.K#LGTEEFPLIDQTFYPNHK.E Q63537 Synapsin-2 R.TPALSPQRPLTTQQPQSGTLK#EPDSSK.T Q63537 Synapsin-2 K.K#ILGDYDIK.V Q02563 Synaptic vesicle glycoprotein 2A R.RK#DREELAQQYETILR.E Q63564 Synaptic vesicle glycoprotein 2B K.VFTVSHIK#TPK.Q Q62876 Synaptogyrin-1 -.M]EGGAYGAGK#AGGAFDPYTLVR.Q Q62910 Synaptojanin-1 K.LAGIQEFQDK#R.S Q62910 Synaptojanin-1 R.DVAVDTVK#TGMGGATGNK.G Q62910 Synaptojanin-1 R.VSEQTLQSASSK#VLK.N Q9WVJ4 Synaptojanin-2-binding protein R.LQEGDK#ILSVNGQDLK.N Q9Z327 Synaptopodin K.GQVVPANK#TGILEESMAR.R Q9Z327 Synaptopodin K.VYSEVHLTLAK#PASVVNR.T R.M%EK#YVIESSGHAELAR.C Q9Z327 Synaptopodin Q9Z327 Synaptopodin K.VTPNPDLLDLVQTADEK#RR.Q K.GQVVPANK#TGILEESM%AR.R Q9Z327 Synaptopodin Q9Z327 Synaptopodin R.HFGEK#AWAPPASSMADR.S Q9Z327 Synaptopodin R.MEK#YVIESSGHAELAR.C R.SPPSYSTLYPSSDPK#PPHLK.G Q9Z327 Synaptopodin Q9Z327 Synaptopodin R.SSILLIDK#VSAPPSAASPFSR.E Q9Z327 Synaptopodin R.AASPAK#PSSLDLVPNLPR.A P21707 Synaptotagmin-1 K.LTVVILEAK#NLK.K Synaptotagmin-1 R.K#TLNPVFNEQFTFK.V P21707 P21707 Synaptotagmin-1 K.NAINMK#DVK.D P21707 Synaptotagmin-1 K.NAINM%K#DVK.D P21707 Synaptotagmin-1 K.IGK#NDAIGK.V Synaptotagmin-1 R.DLQSAEK#EEQEK.L P21707 P21707 Synaptotagmin-1 K.NDAIGK#VFVGYNSTGAELR.H P21707 Synaptotagmin-1 K.N@AINMK#DVK.D P21707 Synaptotagmin-1 K.GGK#NAINMK.D Synaptotagmin-1 K.VFLLPDKK#K.K P21707 P21707 Synaptotagmin-1 R.FSK#HDIIGEFK.V P21707 Synaptotagmin-1 K.DQALK#DDDAETGLTDGEEKEEPKEEEK.L O08835 Synaptotagmin-11 K.GISIYPETLSNK#K.K K.K#GLLPR.D Q925B5 Synaptotagmin-13 P29101 Synaptotagmin-2 K.GMK#NAM%NMK.D P40748 Synaptotagmin-3 K.LIGQIK#PELYQGTGPGGR.R K.SQAQAQVHLQEVK#ELGR.S P47861 Synaptotagmin-5 P47861 Synaptotagmin-5 K.K#SQAQAQVHLQEVK.E K.K#APTNEFYA.P34901 Syndecan-4 P32851 Syntaxin-1A K.LK#SIEQSIEQEEGLNR.S Syntaxin-1B K.LK#AIEQSIEQEEGLNR.S P61265 P61265 Syntaxin-1B K.M%DSQMTK#QALNEIETR.H Syntaxin-1B K.MDSQMTK#QALNEIETR.H P61265 P61265 Syntaxin-1B K.M%DSQM%TK#QALNEIETR.H P61265 Syntaxin-1B K.MDSQM%TK#QALNEIETR.H P61265 Syntaxin-1B R.K#FVEVMTEYNATQSK.Y P61265 Syntaxin-1B K.FVEVMTEYNATQSK#YR.D Syntaxin-1B K.QHSAILAAPNPDEK#TK.Q P61265 P61265 Syntaxin-1B K.K#QHSAILAAPNPDEK.T P61265 Syntaxin-1B K.FVEVM%TEYNATQSK#YR.D Syntaxin-1B K.AVK#YQSK.A P61265 P61265 Syntaxin-1B R.HNEIIK#LETSIR.E P61265 Syntaxin-1B K.LAIFTDDIK#M%DSQM%TK.Q Syntaxin-1B K.LAIFTDDIK#MDSQMTK.Q P61265 Q63635 Syntaxin-6 K.GEVQK#AVNTAQGLFQR.W O70257 Syntaxin-7 R.QQLQQEQQYTNQLAK#ETDK.Y Q9Z2Q7 Syntaxin-8 R.LLLASFK#NEGSEPDLIR.S P61765 Syntaxin-binding protein 1 K.SVHSLISDFK#DPPTAK.Y Syntaxin-binding protein 1 K.AVVGEK#IMHDVIKK.V P61765 P61765 Syntaxin-binding protein 1 R.HK#HIAEVSQEVTR.S P61765 Syntaxin-binding protein 1 K.LDTK#HYPYISTR.S Syntaxin-binding protein 1 R.SLK#DFSSSK.R P61765

2.053 2.053 1.946 1.946 1.946 4.503 2.307 2.307 2.307 2.963 2.772 2.772 2.772 2.331 2.331 2.331 2.331 2.331 2.539 1.942 1.942 2.179 2.179 2.179 3.263 3.406 2.951 2.172 2.172 2.172 2.172 2.272 2.491 2.491 2.491 2.491 2.491 2.491 2.491 2.491 2.491 2.491 2.415 2.415 2.415 2.415 2.415 2.415 2.415 2.415 2.415 3.068 1.841 1.841 1.841 1.841 1.841 2.854 2.854 3.273 3.273 3.273 3.273 3.273 3.273 2.737 2.68 2.68 2.68 2.615 3.848 2.315 3.443 3.443 2.388 2.388 4.455 3.621 4.467 2.346 2.346 2.346 2.51 2.399 2.399 2.399 2.399 2.399 2.399 2.399 2.399 2.399 2.399 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.008 2.898 1.856 1.56 3.01 3.125 3.125 1.902 3.681 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 1.806 2.644 4.086 2.638 2.177 2.177 2.177 2.177 2.177

0.237 0.237 0.37 0.37 0.37 0.421 0.273 0.273 0.273 0.336 0.295 0.295 0.295 0.106 0.106 0.106 0.106 0.106 0.167 0.223 0.223 0.194 0.194 0.194 0.629 0.443 0.711 0.314 0.314 0.314 0.314 0.231 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.121 0.398 0.199 0.199 0.199 0.199 0.199 0.266 0.266 0.221 0.221 0.221 0.221 0.221 0.221 0.341 0.391 0.391 0.391 0.591 0.727 0.06 0.564 0.564 0.262 0.262 0.577 0.134 0.49 0.065 0.065 0.065 0.536 0.191 0.191 0.191 0.191 0.191 0.191 0.191 0.191 0.191 0.191 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.226 0.668 0.22 0.224 0.215 0.384 0.384 0.403 0.326 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.275 0.277 0.136 0.692 0.309 0.309 0.309 0.309 0.309

3 3 3 3 3 3 2 2 2 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 3 3 3 3 3 3 3 3 2 2 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 4 4 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 2 3 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3

396.1972 396.1972 392.8707 392.8707 392.8707 761.6954 473.7569 473.7569 473.7569 472.9206 614.9903 614.9903 614.9903 661.6592 661.6592 661.6592 661.6592 661.6592 615.8206 871.4129 871.4129 525.265 525.265 525.265 556.6487 665.9907 502.9751 631.6735 631.6735 631.6735 631.6735 615.3146 422.9009 422.9009 422.9009 422.9009 422.9009 422.9009 422.9009 422.9009 422.9009 422.9009 588.2933 588.2933 588.2933 588.2933 588.2933 588.2933 588.2933 588.2933 588.2933 728.6786 493.7721 493.7721 493.7721 493.7721 493.7721 514.6142 514.6142 861.4589 861.4589 861.4589 861.4589 861.4589 861.4589 611.3267 630.8214 630.8214 630.8214 540.9702 698.0334 643.0091 797.7386 797.7386 393.552 393.552 721.3796 457.5975 782.04 573.6485 573.6485 573.6485 624.3342 578.794 578.794 578.794 578.794 578.794 578.794 578.794 578.794 578.794 578.794 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 523.7737 782.4219 399.2537 577.7598 666.6983 569.9755 569.9755 577.7773 663.0079 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 469.2587 620.661 812.3992 672.6966 536.6102 536.6102 536.6102 536.6102 536.6102


Page 44 of 60 1 1 2 2 1 1 6 1 1 5 2 1 1 3 2 1 1 1 1 2 1 1 1 1 1 2 2 2 1 1 1 1 15 5 5 2 2 1 1 1 1 1 3 2 2 2 2 1 1 1 1 1 3 2 2 1 1 4 1 10 8 2 2 2 1 1 7 3 2 11 2 3 19 6 2 1 2 2 2 7 2 1 3 6 5 4 3 3 2 2 1 1 1 9 9 6 5 4 4 4 2 1 1 1 1 19 1 1 3 4 3 2 17 24 21 19 16 14 7 6 5 5 2 1 1 1 1 1 1 1 8 3 2 1 1

133 133 5 5 5 1 8 8 8 5 4 4 4 8 8 8 8 8 1 3 3 3 3 3 1 2 2 5 5 5 5 1 34 34 34 34 34 34 34 34 34 34 15 15 15 15 15 15 15 15 15 1 9 9 9 9 9 5 5 25 25 25 25 25 25 1 12 12 12 11 2 3 25 25 3 3 2 2 2 10 10 10 3 28 28 28 28 28 28 28 28 28 28 47 47 47 47 47 47 47 47 47 47 47 47 19 1 1 3 7 7 2 17 123 123 123 123 123 123 123 123 123 123 123 123 123 123 1 1 1 15 15 15 15 15


Page 45 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


P37377 Synuclein, alpha K.TVEGAGNIAAATGFVK#K.D P37377 Synuclein, alpha K.TK#EGVLYVGSK.T Q63754 Synuclein, beta K.EGVVQGVASVAEK#TK.E B5DEZ4 Tcerg1 protein K.EAAM%EAEIK#AAR.E P28480 T-complex protein 1 subunit alpha K.DDK#HGGYENAVHSGALDD.P28480 T-complex protein 1 subunit alpha K.LHPESK#DDK.H P28480 T-complex protein 1 subunit alpha K.LHPESKDDK#HGGYENAVHSGALDD. Q6P502 T-complex protein 1 subunit gamma R.GASK#EILSEVER.N Q6AYM2 Tektin-2 K.M%M%NLK#LAHTR.L Q6P5P3 Tetratricopeptide repeat protein 9C K.RLQEAQLYK#EEGNQR.Y P11232 Thioredoxin K.EK#LEATITEFA.Q5M7W1 Thioredoxin-interacting protein K.VYGSGEK#VAGR.V Q920J4 Thioredoxin-like protein 1 K.LYSMK#FQGPDNGQGPK.Y Q920J4 Thioredoxin-like protein 1 K.LYSM%K#FQGPDNGQGPK.Y Q920J4 Thioredoxin-like protein 1 R.IDQYQGADAVGLEEK#IK.Q D3Z9G0 Tnf receptor-associated factor 3 (Predicted) R.VTELESVDK#SAGQAAR.N Q5U1Z2 Trafficking protein particle complex subunit 3 K.FVQDTLK#GDGVTEIR.M Q64232 Trans-2,3-enoyl-CoA reductase R.SYLK#EFR.D K.LAPTLSVK#AAQTSDLEK.I Q9EQS0 Transaldolase Q9EQS0 Transaldolase R.IIELYK#EAGISK.D Q9EQS0 Transaldolase R.RIIELYK#EAGISK.D Q9EQS0 Transaldolase K.SVTK#IYNYYK.K K.DSSK#LAPTLSVK.A Q9EQS0 Transaldolase Q5PPP3 Transcription elongation factor A protein-like 1 R.AADELEEMK#R.V Q63801 Transcription initiation factor TFIID subunit 6 K.GKGQGAAAADGK#GK.E O08629 Transcription intermediary factor 1-beta R.VLVNDAQK#VTEGQQER.L G3V679 Transferrin receptor, isoform CRA_a K.LAADEEENADSNMK#ASVR.K P50137 Transketolase K.K#ILATPPQEDAPSVDIANIR.M P50137 Transketolase R.GITGIEDK#EAWHGKPLPK.N Q53AQ4 Transmembrane and ubiquitin-like domain-containingR.LK#FLNDSEQVAR.A Q6AYA5 Transmembrane protein 106B K.SLSHLPLHSNK#EDGYDGVTSTDNM%R.N Q6AYA5 Transmembrane protein 106B K.SLSHLPLHSNK#EDGYDGVTSTDNMR.N Q925D4 Transmembrane protein 176B K.LLGGDSAPASPTK#EK.I Q925D4 Transmembrane protein 176B K.K#LLGGDSAPASPTK.E Q5HZE8 Transmembrane protein 59-like K.LK#LDLTTL.P48500 Triosephosphate isomerase R.EAGITEK#VVFEQTK.A P48500 Triosephosphate isomerase K.VVFEQTK#AIADNVK.D P48500 Triosephosphate isomerase K.LDEREAGITEK#VVFEQTK.A P48500 Triosephosphate isomerase K.VVLAYEPVWAIGTGK#TATPQQAQEVHEK.L Q64560 Tripeptidyl peptidase II R.EK#LPANQYTWSSR.G Q64560 Tripeptidyl peptidase II K.YNQPFFVTSLPDDK#IPK.G K.VNESSHYDLAFTDVHFK#PGQIR.R Q64560 Tripeptidyl peptidase II Q6AYT3 tRNA-splicing ligase RtcB homolog R.VASPK#LVMEEAPESYK.N K.VEQHVVDGK#ER.T Q6AYT3 tRNA-splicing ligase RtcB homolog P70566 Tropomodulin-2 K.EALEQK#DREDFVPFTGEK.K K.TVTNNLK#SLEAQAEK.Y P04692 Tropomyosin alpha-1 chain P04692 Tropomyosin alpha-1 chain R.LATALQK#LEEAEK.A Q63610 Tropomyosin alpha-3 chain K.LEK#TIDDLEDK.L Q6P7B0 Tryptophanyl-tRNA synthetase, cytoplasmic R.K#AVTEETVK.E Q6P7B0 Tryptophanyl-tRNA synthetase, cytoplasmic R.RK#AVTEETVK.E P62501 TSC22 domain family protein 1 K.ELIEK#NSQLEQENNLLK.T P62501 TSC22 domain family protein 1 R.EEVEVLK#EQIK.E Q5XIF6 Tubulin alpha-4A chain R.GDVVPK#DVNAAIAAIK.T Q5XIF6 Tubulin alpha-4A chain K.DVNAAIAAIK#TK.R Q5XIF6 Tubulin alpha-4A chain R.GHYTIGK#EIIDPVLDR.I P85108 Tubulin beta-2A chain R.INVYYNEAAGNK#YVPR.A Q6P9T8 Tubulin beta-4B chain R.INVYYNEATGGK#YVPR.A P69897 Tubulin beta-5 chain R.K#LAVNMVPFPR.L P69897 Tubulin beta-5 chain R.ISVYYNEATGGK#YVPR.A P69897 Tubulin beta-5 chain R.K#LAVNM%VPFPR.L Q5PPN5 Tubulin polymerization-promoting protein family memK.K#ALEELATK.R P68370 Tubulin, alpha chain K.VGINYQPPTVVPGGDLAK#VQR.A P68370 Tubulin, alpha chain R.GDVVPK#DVNAAIATIK.T P68370 Tubulin, alpha chain K.DVNAAIATIK#TK.R P68370 Tubulin, alpha chain R.LDHK#FDLMYAK.R P68370 Tubulin, alpha chain R.QLFHPEQLITGK#EDAANNYAR.G P68370 Tubulin, alpha chain K.TIGGGDDSFNTFFSETGAGK#HVPR.A P68370 Tubulin, alpha chain R.LSVDYGK#K.S P68370 Tubulin, alpha chain R.LDHK#FDLM%YAK.R P68370 Tubulin, alpha chain K.FDLMYAK#R.A P68370 Tubulin, alpha chain K.DVNAAIATIK#TK#R.S NP_001101670.1 tubulin-specific chaperone C K.RQDQEVEEEK#SGFFAAAFAR.E D4A383 Tweety homolog 3 (Drosophila) (Predicted) R.AK#YLATSQPRPDSSGSGH.Q4V8P5 Txndc3 protein R.KLSLSLM%M%K#KK.K Q6P6U0 Tyrosine-protein kinase Fgr R.TGDDLTFTK#GEK.F Q07014 Tyrosine-protein kinase Lyn K.DNLNDDGVDMK#TQPVR.N Q07014 Tyrosine-protein kinase Lyn K.DNLNDDGVDM%K#TQPVR.N P57097 Tyrosine-protein kinase Mer R.LQLEK#LSESLPDAQDK.E P97710 Tyrosine-protein phosphatase non-receptor type subsR.LHEPEK#NAR.E Q9JJP9 Ubiquilin 1 K.EK#EEFAVPENSSVQQFK.E D4AA63 Ubiquilin 2 (Predicted) K.EK#EEFAVPENSTVQQFK.E D4AA63 Ubiquilin 2 (Predicted) K.VTVK#TPK.E P62982 Ubiquitin R.LIFAGK#QLEDGR.T P62982 Ubiquitin R.TLSDYNIQK#ESTLHLVLR.L P62982 Ubiquitin K.TLTGK#TITLEVEPSDTIENVK.A K.IQDK#EGIPPDQQR.L P62982 Ubiquitin P62982 Ubiquitin -.M%QIFVK#TLTGK.T R.LIFAGK#QLEDGRTLSDYNIQK.E P62982 Ubiquitin P62982 Ubiquitin -.MQIFVK#TLTGK.T P62982 Ubiquitin K.TITLEVEPSDTIENVK#AK. K.QLEDGRTLSDYNIQK#ESTLHLVLR.L P62982 Ubiquitin P62982 Ubiquitin K.AK#IQDK#EGIPPDQQR.L D3ZCY2 Ubiquitin carboxyl-terminal hydrolase K.LK#PMYGPGYTGLK.N D3ZCY2 Ubiquitin carboxyl-terminal hydrolase R.GLQPGEEELPDISPPIVIPDDSK#DR.L R.QSVAQLPDPESLHGEQK#IEAETR.A D3ZLQ8 Ubiquitin carboxyl-terminal hydrolase B2GUZ1 Ubiquitin carboxyl-terminal hydrolase 4 R.DK#LDTVVEFPVR.A Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M%QLK#PM%EINPEM%LNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M%QLK#PMEINPEM%LNK.V -.MQLK#PM%EINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M%QLK#PM%EINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.MQLK#PMEINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.MQLK#PM%EINPEM%LNK.V -.M%QLK#PMEINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.MQLK#PMEINPEM%LNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M]QLK#PMEINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 K.QIEELK#GQEVSPK.V K.QFLSETEK#LSPEDR.A Q00981 Ubiquitin carboxyl-terminal hydrolase L1 Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M]QLK#PM%EINPEMLNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 -.M]QLK#PM%EINPEM%LNK.V -.M]QLK#PMEINPEM%LNK.V Q00981 Ubiquitin carboxyl-terminal hydrolase L1 D3ZYT1 Ubiquitin specific peptidase 14 R.LQEEITK#QSPTLQR.N K.MWNK#ELYVR.E F1LSM0 Ubiquitin specific peptidase 24 F1LSM0 Ubiquitin specific peptidase 24 K.M%WNK#ELYVR.E Ubiquitin specific peptidase 25 R.LVLNYK#PPSNAQDLPR.N D4ACD3 F1LYJ4 Ubiquitin specific peptidase 34 K.TYTMDK#QPLNTGEQK.D K.TYTM%DK#QPLNTGEQK.D F1LYJ4 Ubiquitin specific peptidase 34 D3ZVQ0 Ubiquitin specific peptidase 5 R.SAADSISESVPVGPK#VR.D D3ZVQ0 Ubiquitin specific peptidase 5 K.LEK#IFQNAPTDPTQDFSTQVAK.L D3ZVQ0 Ubiquitin specific peptidase 5 K.HAFNLK#QLDNPAR. D3ZVQ0 Ubiquitin specific peptidase 5 R.HFNK#TGQR.V R.VPK#AGDR.V D3ZVQ0 Ubiquitin specific peptidase 5 D3ZVQ0 Ubiquitin specific peptidase 5 K.SVAVK#TTR.F D3ZVQ0 Ubiquitin specific peptidase 5 K.ALIGK#GHPEFSTNR.Q Ubiquitin specific peptidase 9, X-linked R.DDVFGYPQQFEDK#PPLSK.T D3ZC84 D3ZC84 Ubiquitin specific peptidase 9, X-linked K.QDNESNVDPRDDVFGYPQQFEDK#PPLSK.T Q32Q05 Ubiquitin thioesterase OTU1, Yod1 R.IDRFGEDAGYTK#R.V K.EYAEDDNIYQQK#IK.D B2RYG6 Ubiquitin thioesterase OTUB1 Q5U300 Ubiquitin-activating enzyme E K.QPAENVNQYLTDSK#FVER.T Q5U300 Ubiquitin-activating enzyme E R.YDGQVAVFGSDLQEK#LGK.Q Q5U300 Ubiquitin-activating enzyme E K.ATLPSPDK#LPGFK.M D3ZDK2 Ubiquitin-conjugating enzyme E2D R.EWTQK#YAM.Ubiquitin-conjugating enzyme E2D R.EWTQK#YAM%.D3ZDK2 B2RZA9 Ubiquitin-conjugating enzyme E2L R.IEINFPAEYPFK#PPK.I Q9EQX9 Ubiquitin-conjugating enzyme E2N K.IYHPNVDK#LGR.I R.VQWYPEGVK#QHVK.E F1M403 Ubiquitin-conjugating enzyme E2O

2.295 2.295 2.168 2.084 2.983 2.983 2.983 2.945 1.861 2.713 1.78 2.533 3.847 3.847 3.847 2.869 3.609 1.671 1.709 1.709 1.709 1.709 1.709 2.382 2.032 2.666 3.601 4.502 4.502 2.354 6.251 6.251 2.05 2.05 1.97 2.339 2.339 2.339 2.339 3.181 3.181 3.181 3.558 3.558 2.551 3.181 3.181 3.103 2.525 2.525 3.119 3.119 2.728 2.728 2.728 3.938 2.439 1.999 1.999 1.999 1.676 2.011 2.011 2.011 2.011 2.011 2.011 2.011 2.011 2.011 2.011 4.878 2.349 2.013 2.005 2.513 2.513 3.433 2.45 2.865 1.727 1.727 2.074 2.074 2.074 2.074 2.074 2.074 2.074 2.074 2.074 2.074 2.527 2.527 2.643 2.616 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.417 2.304 1.949 1.949 3.622 2.682 2.682 1.823 1.823 1.823 1.823 1.823 1.823 1.823 3.074 3.074 2.363 3.073 1.903 1.903 1.903 2.197 2.197 2.052 2.871 2.114

0.217 0.217 0.044 0.138 0.075 0.075 0.075 0.35 0.21 0.318 0.437 0.465 0.022 0.022 0.022 0.34 0.628 0.245 0.499 0.499 0.499 0.499 0.499 0.454 0.182 0.195 0.397 0.381 0.381 0.397 0.82 0.82 0.428 0.428 0.533 0.1 0.1 0.1 0.1 0.205 0.205 0.205 0.512 0.512 0.255 0.226 0.226 0.212 0.271 0.271 0.299 0.299 0.146 0.146 0.146 0.738 0.308 0.592 0.592 0.592 0.088 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.353 0.717 0.283 0.119 0.203 0.717 0.717 0.43 0.263 0.312 0.18 0.18 0.381 0.381 0.381 0.381 0.381 0.381 0.381 0.381 0.381 0.381 0.316 0.316 0.281 0.437 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.2 0.067 0.298 0.298 0.716 0.346 0.346 0.249 0.249 0.249 0.249 0.249 0.249 0.249 0.227 0.227 0.152 0.134 0.218 0.218 0.218 0.51 0.51 0.171 0.391 0.164

2 2 3 3 3 3 3 2 3 3 2 2 3 3 3 3 2 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 2 2 2 3 3 2 2 2 2 2 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 3 3 3 4 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 3 3 4 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 3 3 3 2 2 2 2 2 2 2 4 4 4 2 3 3 3 2 2 3 3 3

647.8526 647.8526 539.2917 473.9025 902.4125 902.4125 902.4125 716.375 454.2332 659.3359 683.3486 618.8196 664.3401 664.3401 664.3401 592.3019 896.4649 528.7775 696.861 696.861 696.861 696.861 696.861 653.3085 665.3504 643.3325 688.6483 697.3707 697.3707 511.9386 963.1139 963.1139 485.9313 485.9313 515.8113 559.305 559.305 559.305 559.305 565.2803 565.2803 565.2803 470.5753 470.5753 751.366 779.4275 779.4275 716.8623 425.5737 425.5737 729.3956 729.3956 664.8795 664.8795 664.8795 662.3333 653.3306 467.9275 467.9275 467.9275 558.8171 386.5303 386.5303 386.5303 386.5303 386.5303 386.5303 386.5303 386.5303 386.5303 386.5303 810.3845 658.3214 363.9633 475.9 649.6324 649.6324 643.3369 403.21 704.0072 443.7725 443.7725 566.2904 566.2904 566.2904 566.2904 566.2904 566.2904 566.2904 566.2904 566.2904 566.2904 513.6055 513.6055 669.836 511.2751 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 663.3265 595.6542 684.8404 684.8404 647.0166 628.6308 628.6308 551.2804 551.2804 551.2804 551.2804 551.2804 551.2804 551.2804 845.3925 845.3925 411.2051 935.9442 495.6083 495.6083 495.6083 593.7633 593.7633 635.3358 475.9241 571.3016


3 1 1 1 4 3 1 3 1 1 2 5 7 5 2 1 5 1 8 4 2 1 1 3 1 2 1 3 2 1 6 1 3 2 1 17 1 1 1 2 2 2 5 1 2 3 1 1 3 2 5 1 9 1 1 2 1 6 4 2 1 87 20 16 8 7 6 5 2 1 1 1 3 1 1 6 2 16 1 22 33 1 576 533 282 148 125 108 47 10 5 1 1 1 2 10 206 59 43 37 24 16 14 14 10 9 8 5 2 1 2 16 11 3 3 1 68 44 9 1 1 1 1 2 1 1 5 4 2 1 3 1 3 17 3

4 4 1 1 8 8 8 3 1 1 2 5 14 14 14 1 5 1 16 16 16 16 16 3 1 2 1 5 5 1 7 7 5 5 1 20 20 20 20 6 6 6 6 6 2 4 4 1 5 5 6 6 11 11 11 2 1 12 12 12 1 153 153 153 153 153 153 153 153 153 153 1 3 1 1 8 8 16 1 22 34 34 1835 1835 1835 1835 1835 1835 1835 1835 1835 1835 2 2 2 10 448 448 448 448 448 448 448 448 448 448 448 448 448 448 2 27 27 3 4 4 125 125 125 125 125 125 125 3 3 1 5 7 7 7 4 4 3 17 3

K96 K34 K58 K628 K541 K538 K541 K381 K312 K12 K96 K26 K181 K181 K102 K368 K156 K291 K277 K130 K130 K219 K269 K144 K191 K321 K53 K283 K254 K107 K14 K14 K256 K243 K325 K142 K149 K142 K175 K401 K958 K655 K465 K366 K81 K205 K112 K215 K454 K454 K86 K77 K326 K336 K112 K58 K58 K252 K58 K252 K77 K370 K326 K336 K394 K96 K60 K163 K394 K401 K336,K338 K55 K508 K225 K88 K20 K20 K851 K417 K38 K43 K38 K48 K63 K11 K33 K6 K48 K6 K27 K63 K29,K33 K326 K638 K907 K835 K4 K4 K4 K4 K4 K4 K4 K4 K4 K71 K123 K4 K4 K4 K265 K1760 K1760 K202 K1737 K1737 K793 K360 K184 K64 K20 K558 K423 K1627 K1627 K252 K71 K671 K465 K838 K144 K144 K64 K82 K126


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

D3ZXV0 P56558 P56558 P56558 Q4KM73 A0JPI6 D3Z887 D3Z8E6 D3Z912 D3Z9C0 D3Z9D0 D3Z9G3 D3Z9M4 D3Z9M4 D3Z9U0 D3ZAU7 D3ZBJ7 D3ZBY8 D3ZCG2 D3ZCS3 D3ZD04 D3ZE47 D3ZEI4 D3ZEI4 D3ZEI4 D3ZER6 D3ZFB6 D3ZFY7 D3ZFY7 D3ZFY7 D3ZG78 D3ZG78 D3ZGD3 D3ZH36 D3ZI32 D3ZIC5 D3ZJX3 D3ZJX3 D3ZK27 D3ZKY3 D3ZL58 D3ZLR7 D3ZNF1 D3ZNM2 D3ZNW8 D3ZQ93 D3ZQY4 D3ZQY4 D3ZRK1 D3ZSB6 D3ZSI4 D3ZSM8 D3ZSM8 D3ZSM8 D3ZSM8 D3ZSP5 D3ZSQ1 D3ZSQ6 D3ZSU2 D3ZSU6 D3ZT20 D3ZTB5 D3ZTG3 D3ZTM3 D3ZTN1 D3ZTZ8 D3ZTZ8 D3ZU79 D3ZUK1 D3ZUM0 D3ZUM0 D3ZUT1 D3ZW46 D3ZW85 D3ZW96 D3ZWA1 D3ZWP6 D3ZY92 D3ZYA1 D3ZYX5 D3ZYX5 D3ZZP8 D3ZZP8 D3ZZZ0 D4A059 D4A1P7 D4A1S3 D4A1S3 D4A1T3 D4A1Y4 D4A2W6 D4A3D8 D4A3M1 D4A498 D4A4D8 D4A4G6 D4A560 D4A6W0 D4A767 D4A781 D4A783 D4A7T9 D4A8V0 D4A8V0 D4A9C9 D4AA77 D4AAM6 D4ABH0 D4ACM9 D4ACV9 D4AD26 D4AD79 D4AD79 D4ADF6 E9PSK0 E9PSL7 E9PSR4 E9PST0 E9PSZ5 E9PT65 E9PT65 E9PT65 E9PTC8 E9PTK5 E9PTS0 E9PTW6 E9PU13 F1LM24 F1LM24 F1LM24 F1LM24 F1LM24 F1LM24 F1LMA5 F1LMA5

Ubiquitin-conjugating enzyme E2QL K.EAEATFK#SLVK.T UDP-N-acetylglucosamine--peptide N-acetylglucosamR.ISSPLFNTK#QYTMELER.L UDP-N-acetylglucosamine--peptide N-acetylglucosamR.ISSPLFNTK#QYTM%ELER.L UDP-N-acetylglucosamine--peptide N-acetylglucosamK.DLK#LSDGR.L UMP-CMP kinase R.K#NPDSQYGELIEK.Y Uncharacterized protein K.ERYEK#EFSQER.Q Uncharacterized protein K.VEEEIQTLSQVLAAK#EK.H Uncharacterized protein R.DIQELK#DAK.T Uncharacterized protein K.GEQIAK#ESQDLK.E Uncharacterized protein R.HNWSGLDK#QTDIQNLNEER. Uncharacterized protein K.LQIPSVK#GFDFAK.Q Uncharacterized protein K.EK#GTWVQLK.R Uncharacterized protein K.EGHVK#M%VVELLHK.E Uncharacterized protein K.EGHVK#MVVELLHK.E Uncharacterized protein R.GTLAYLPEEYIK#TGR.L Uncharacterized protein K.VESAQQPK#QVLK.M Uncharacterized protein K.TK#KFDIDEAEEAK.D Uncharacterized protein R.TTNEQVTGK#FR.G K.GLQAAQK#EAQIK.V Uncharacterized protein Uncharacterized protein K.EVGSIIGK#K.G Uncharacterized protein -.M]IEDSGK#R.G Uncharacterized protein R.K#TTEEEEEDELHIGR.T R.K#NPMALYILK.D Uncharacterized protein Uncharacterized protein K.DK#DSSEPDENPATEPR.S Uncharacterized protein R.K#LEKQNSLEYMDQNDDRLK.S Uncharacterized protein R.SLSGLILK#NNVK.A Uncharacterized protein R.VLQK#LVEEDRIGR.A Uncharacterized protein K.EGGK#DLLSTEGNEPVGLK.K Uncharacterized protein K.DLLSTEGNEPVGLK#K.S Uncharacterized protein K.NAVSVHHALASK#ATEYEK.K Uncharacterized protein K.KTDSFFLEVQK#R.F Uncharacterized protein K.TDSFFLEVQK#R.F Uncharacterized protein R.EK#LLETLR.A Uncharacterized protein K.LPASK#GLEAGLDTPK.V Uncharacterized protein K.VIHEK#DGQIK.S Uncharacterized protein R.GQSMK#SYPSSELR.N Uncharacterized protein R.SIQK#LLEWENNR.L Uncharacterized protein R.RSIQK#LLEWENNR.L Uncharacterized protein K.VSQLMEWTNKRPVIRM%NGDK#FR.R Uncharacterized protein R.TNLFSREEVTSYQRK#LPPK.G Uncharacterized protein R.QLFK#ELYIDPSK.V Uncharacterized protein R.ALVDALK#K.W Uncharacterized protein K.APK#SSFIGDGDIFK.K Uncharacterized protein R.LQEDTDK#ANK.H Uncharacterized protein R.DVSK#ALVGLEGAPATR.L K.NYGSYSTQATAAAATAELLK#K.Q Uncharacterized protein Uncharacterized protein K.NPSIK#SADQLTTFLK.H Uncharacterized protein R.ALK#QPLSANTLSDVLSR.L Uncharacterized protein R.SLSTK#YETTIF.Uncharacterized protein K.QSSEM%K#GDDLEEGVTSEEFDK.F Uncharacterized protein K.GAIQLGITHTVGSLSTK#PER.D Uncharacterized protein R.IISPK#NNPPTIVQDK.V Uncharacterized protein R.SSLEDTYGAGDGLK#R.G Uncharacterized protein R.DLSDAGK#R.G Uncharacterized protein K.LDDFIK#NLR.G Uncharacterized protein R.VANATK#IALYETPTGWK.F Uncharacterized protein R.GSIQNAK#QALR.N Uncharacterized protein K.QEK#AKPAAKPK.K Uncharacterized protein K.TQPDVMSQNAK#K.L Uncharacterized protein R.K#LPFTVGANGEQKDSDTEKQGPER.K Uncharacterized protein R.LSEEVEQK#IAGQVGR.L Uncharacterized protein K.MK#SLDVNQDSELK.F Uncharacterized protein R.NPTQSLEPSIGSK#QPK.H Uncharacterized protein K.AGK#YLEHGEYEGNLYGTK.I Uncharacterized protein R.K#ENFNNVPDLELNPIR.S Uncharacterized protein R.K#TVTYEDPQAVGGLASALDNR.K Uncharacterized protein R.TDLK#GDDLEEGVTSEEFDK.F Uncharacterized protein K.DIDDLK#K.I Uncharacterized protein K.TTGPSK#QFDK.N Uncharacterized protein K.AK#DMPPLMDPTLK.E Uncharacterized protein K.AK#DMPPLM%DPTLK.E Uncharacterized protein R.LTHSMK#EVGGSHK.Q Uncharacterized protein R.SNSSSPVDK#LNQQPR.L Uncharacterized protein R.STTSNNLSVQK#IYAQEK.F Uncharacterized protein K.QLENLEQQK#YDDEDISEDIK.F Uncharacterized protein K.K#LQEEEDRR.A Uncharacterized protein K.QLLSDLIDK#NLENK.N Uncharacterized protein R.LNQVIFPVSYNDK#FYK.D Uncharacterized protein R.TSFQGEK#SAVI.Uncharacterized protein R.GPAVQATK#AAAGTK.K Uncharacterized protein R.RGPAVQATK#AAAGTK.K Uncharacterized protein R.ILK#AHGEK.G Uncharacterized protein K.SSK#SQDGSPAPAPVRPSTTLR.N Uncharacterized protein K.K#DLGQGPLATSGAVEEPQATPER.L Uncharacterized protein R.QLLVGLADK#NIQYYEK.C Uncharacterized protein K.QFAK#EAAFTADFGLK.S Uncharacterized protein R.LIVNK#NAGETLLQR.A Uncharacterized protein R.K#IPVNDGDASK#AR.L Uncharacterized protein R.SLEK#NYPRWLTSQK.S Uncharacterized protein K.GVK#YEAPQTTDGLAGALDAR.Q Uncharacterized protein R.TVGNEVIAVDWK#GLK.D Uncharacterized protein K.AVEIEIETPEQAK#AR.E Uncharacterized protein R.LNEFLK#GEGMTMGELTR.V Uncharacterized protein R.QNVYIPGSNATLTNAAGK#R.D Uncharacterized protein K.K#VLGYDETIK.A Uncharacterized protein K.SAFPFSDK#LGELSDK.I Uncharacterized protein R.LDELQDK#SESLSDNATAFSNR.S Uncharacterized protein K.K#QDISVHKLK.L Uncharacterized protein K.GEEAMPSEESMM%DSGK#TLAEISDR.Y Uncharacterized protein K.HIVENAVQK#ELR.L Uncharacterized protein K.AEAAAPAK#AQAQAPAQAPK.G Uncharacterized protein R.DIDTQAK#YQSYFSR.G Uncharacterized protein K.LFVGM%LNK#QQSEEDVLR.L Uncharacterized protein K.LFVGMLNK#QQSEEDVLR.L Uncharacterized protein R.ILSK#LHTVQPK.G Uncharacterized protein K.IPEGASLAMSLTDK#K.D Uncharacterized protein R.LTQK#ADYTATAK.G Uncharacterized protein K.GGETPGSEQWK#FQELSQPR.S Uncharacterized protein R.EDREALEK#EKAEIER.M Uncharacterized protein R.ELTLK#VLR.S Uncharacterized protein K.EYLTK#VDAIK.E Uncharacterized protein R.SVTLLVK#GPNK.H Uncharacterized protein K.HK#SETDTSLIR.G Uncharacterized protein K.NK#GVISSVDGMSLEGFPSEK.I Uncharacterized protein R.TKIGQLK#GDPWISLP.Uncharacterized protein K.AEILALQQALK#EQK.L Uncharacterized protein K.FISKTPSKEEVEK#EGEENGLR.Q Uncharacterized protein R.ESGTDFPIPAVPPGTDPETEK#LIR.E Uncharacterized protein R.SSLLTEK#LLR.L Uncharacterized protein R.VLEQHK#LTK.E Uncharacterized protein K.K#QLQALSSELAQARDETK.K Uncharacterized protein K.K#QLQALSSELAQAR.D Uncharacterized protein R.REPFAVVK#TASEMER.V Uncharacterized protein -.S]K#LPGDLAGDLER.S Uncharacterized protein K.M%FVGGLSWDTSK#K.D Uncharacterized protein K.VHK#ISNPWQSPSGTLPALR.T Uncharacterized protein K.VLEEQINEGEQQLK#SK.N Uncharacterized protein K.LAVTSYNDIQDLMDSGNK#AR.T Uncharacterized protein K.LAVTSYNDIQDLM%DSGNK#AR.T Uncharacterized protein R.ELK#DEVTR.L Uncharacterized protein K.VISALAEMDSGPNK#NK.K R.LK#EGANINK.S Uncharacterized protein Uncharacterized protein R.HDEAFSTEPLK#NTGR.G Uncharacterized protein R.TK#LMLGPNPTRK.D R.TK#LM%LGPNPTRK.D Uncharacterized protein

2.806 2.169 2.169 2.169 3.519 2.587 3.484 1.942 2.911 2.854 2.067 1.612 2.599 2.599 2.864 2.362 1.851 2.312 3.855 1.604 2.077 4.236 2.888 2.888 2.888 2.641 2.689 3.349 3.349 3.349 2.422 2.422 1.885 4.066 2.423 3.006 3.398 3.398 2.844 2.762 2.517 2.224 3.864 3.028 3.157 3.711 2.295 2.295 1.667 2.092 2.396 2.07 2.07 2.07 2.07 3.831 2.32 1.826 1.913 2.798 3.29 2.55 1.874 4.824 4.071 4.711 4.711 1.628 2.138 2.451 2.451 1.917 2.15 2.56 4.211 2.286 2.926 2.348 2.263 3.258 3.258 1.82 1.82 1.963 1.829 2.045 2.071 2.071 2.03 4.441 2.924 2.385 2.901 2.437 2.245 2.754 4.19 1.708 1.887 3.801 2.033 2.842 2.76 2.76 2.166 2.935 2.212 3.111 2.041 1.858 2.273 2.211 2.211 2.049 1.956 3.63 2.79 3.265 1.922 2.155 2.155 2.155 4.366 2.713 2.221 5.287 3.586 2.012 2.012 2.012 2.012 2.012 2.012 2.636 2.636

0.328 0.229 0.229 0.229 0.336 0.237 0.022 0.216 0.386 0.291 0.184 0.351 0.612 0.612 0.317 0.269 0.053 0.587 0.482 0.166 0.485 0.578 0.025 0.025 0.025 0.188 0.178 0.692 0.692 0.692 0.199 0.199 0.283 0.538 0.282 0.434 0.527 0.527 0.196 0.069 0.528 0.022 0.658 0.269 0.167 0.019 0.071 0.071 0.252 0.652 0.668 0.198 0.198 0.198 0.198 0.665 0.187 0.03 0.105 0.016 0.289 0.192 0.078 0.641 0.669 0.594 0.594 0.205 0.222 0.224 0.224 0.148 0.132 0.241 0.475 0.217 0.179 0.053 0.32 0.151 0.151 0.533 0.533 0.139 0.481 0.072 0.185 0.185 0.152 0.74 0.074 0.288 0.633 0.408 0.226 0.381 0.513 0.039 0.019 0.489 0.112 0.306 0.541 0.541 0.277 0.054 0.155 0.691 0.122 0.284 0.38 0.199 0.199 0.689 0.079 0.097 0.157 0.6 0.391 0.213 0.213 0.213 0.646 0.477 0.018 0.707 0.056 0.248 0.248 0.248 0.248 0.248 0.248 0.407 0.407

2 2 2 2 2 3 3 2 3 4 3 2 3 3 3 3 3 3 2 2 2 3 4 4 4 2 4 3 3 3 3 3 2 2 3 2 3 3 4 4 3 2 2 3 3 3 3 3 2 3 3 2 2 2 2 3 3 2 3 4 3 3 3 3 3 3 3 2 3 3 3 2 4 3 3 2 3 3 2 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 2 3 3 2 3 3 3 3 3 3 2 3 3 3 3 2 2 3 3 3 3 3 4 3 3 2 2 2 3 2 3 3 3 3 3 3 3 3 3 3 3

668.858 509.2695 509.2695 509.2695 817.9052 538.9214 677.0323 587.308 487.2506 603.5381 521.956 601.8293 544.9664 544.9664 608.9873 490.2755 546.6069 465.5727 699.8889 522.8057 546.2661 643.6322 621.0565 621.0565 621.0565 700.4173 417.9908 571.9714 571.9714 571.9714 495.2577 495.2577 558.3242 805.9409 427.5696 792.3785 600.6546 600.6546 709.6181 602.5751 532.287 486.2975 798.4048 425.8775 566.6437 758.3867 643.0248 643.0248 702.3569 830.6852 727.0669 488.2463 488.2463 488.2463 488.2463 659.6847 433.9093 655.3837 487.5771 687.0905 586.3102 540.9341 608.9858 715.0095 676.0161 747.6729 747.6729 480.755 408.2072 529.603 529.603 762.884 443.4729 675.6801 856.0654 658.8314 586.3187 697.0296 640.8285 514.2888 514.2888 751.7247 751.7247 822.4135 670.3623 879.4468 533.613 533.613 621.9954 716.3617 581.6502 599.9818 680.669 697.0311 640.3489 585.6255 818.7166 655.3832 910.7206 517.2863 635.3382 612.6232 712.6969 712.6969 689.4145 558.9633 475.5837 759.0301 653.6645 543.338 647.3562 467.5757 467.5757 732.3595 589.6637 566.3229 630.8178 894.1182 425.2536 605.3513 605.3513 605.3513 621.9846 763.8929 529.262 734.7311 662.6747 368.5276 368.5276 368.5276 368.5276 368.5276 368.5276 478.2847 478.2847


Page 46 of 60 9 4 2 1 1 1 2 2 7 5 1 2 3 2 1 1 1 1 4 1 1 1 3 2 1 2 5 7 2 2 2 1 1 9 1 1 27 5 1 1 2 1 3 1 6 1 3 1 1 1 1 13 2 1 1 1 2 1 1 1 1 1 1 1 3 4 3 1 1 2 1 1 1 2 7 7 3 2 1 4 1 3 1 1 2 1 6 2 1 2 1 1 7 5 2 1 2 2 1 1 1 1 3 3 2 1 6 1 1 2 1 4 2 1 2 4 1 4 1 1 1 1 1 1 2 1 2 8 7 1 1 1 1 11 10

9 7 7 7 1 1 2 2 7 5 1 2 5 5 1 1 1 1 4 1 1 1 6 6 6 2 5 11 11 11 3 3 1 9 1 1 32 32 1 1 2 1 3 1 6 1 4 4 1 1 1 20 4 4 4 1 2 1 1 1 1 1 1 1 3 20 20 1 1 3 3 1 1 2 7 7 3 2 1 5 5 4 4 1 2 1 8 8 1 2 1 1 7 5 2 1 2 2 1 1 1 1 6 6 2 1 6 1 1 2 1 6 6 1 2 4 1 4 1 3 3 3 1 1 2 1 2 19 19 19 19 19 19 30 30

K285 K1000 K1000 K540 K43 K96 K94 K346 K80 K479 K1196 K122 K63 K63 K397 K71 K83 K224 K1060 K35 K7 K863 K303 K314 K270 K71 K225 K951 K965 K813 K2464 K2464 K396 K485 K808 K683 K178 K178 K60 K286 K370 K643 K1310 K475 K213 K103 K1779 K1837 K1119 K427 K87 K106 K1127 K1143 K913 K367 K1762 K229 K178 K59 K227 K64 K488 K417 K44 K355 K402 K67 K185 K218 K218 K125 K175 K929 K325 K524 K1415 K33 K227 K1043 K1043 K1874 K1445 K1803 K411 K413 K1444 K30,K40 K232 K409 K19 K171 K111 K910 K293 K208 K87 K302 K140 K548 K130 K658 K105 K105 K74 K1657 K234 K90 K299 K319 K186 K381 K202 K1383 K973 K1149 K43 K352 K3451 K162 K525 K525 K175 K3 K87 K186 K390 K200 K200 K372 K293 K265 K1037 K207 K207

Page 47 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

F1LMA5 F1LMA5 F1LMA5 F1LMJ9 F1LMS1 F1LMS1 F1LNL3 F1LNL3 F1LP70 F1LQ45 F1LQ45 F1LQ45 F1LQ51 F1LQ51 F1LS01 F1M787 F1M787 F1M7W7 F1M7W7 F1M951 F1M9W9 F1MAI3 F8WFM2 F8WFM2 F8WFM2 F8WFM2 F1LM13 F1LM13 F1LM42 F1LM42 F1LM42 F1LM72 F1LMV9 F1LNC6 F1LNE3 F1LP89 F1LPB1 F1LPF3 F1LQ26 F1LQY6 F1LRS0 F1LRY3 F1LRZ1 F1LS72 F1LTW9 F1LTW9 F1LU52 F1LUT4 F1LUT4 F1LUT4 F1LV42 F1LV42 F1LV42 F1LV42 F1LV42 F1LVC3 F1LVD2 F1LWK8 F1LX73 F1LYJ8 F1LYJ8 F1LYJ8 F1LYQ8 F1LYQ8 F1LZF5 F1M0K5 F1M0K5 F1M164 F1M1L4 F1M1T0 F1M1W4 F1M2F8 F1M362 F1M3F0 F1M3Z1 F1M453 F1M4R2 F1M4T7 F1M4U0 F1M516 F1M516 F1M6M9 F1M7Y3 F1M7Y3 F1M844 F1M844 F1M8G9 F1M8G9 F1M8R8 F1M8R8 F1M8Y9 F1M8Y9 F1MA55 F1MA55 Q498C7 Q5PQM8 Q5XI20 Q566Q8 P97689 P0C0A2 Q6AY86 Q6AY86 O08700 O08700 O55166 P84889 P46462 P46462 P46462 P46462 P46462 P46462 P46462 P46462 P46462 P46462 Q63666 P63025 P63025 P63025 P63025 P63025 P63025 P63025 Q9JHW5 Q9JHW5 Q9JHW5 Q62634 Q62634 Q62634 Q62634 Q62634 Q9JI12 P31000 P31000


Uncharacterized protein R.TK#LM%LGPNPTR.K Uncharacterized protein R.TK#LMLGPNPTR.K Uncharacterized protein K.VLLELYIK#EAK.R Uncharacterized protein K.SQGSGLSSGGAGEGQGPK#K.Q Uncharacterized protein R.QGTPVPASGPAAAYK#QSK.A Uncharacterized protein K.EAETK#EEEEEVEK.K Uncharacterized protein K.IK#SLNWYEDNNYK.A Uncharacterized protein K.EVGK#VGEWAIR.K Uncharacterized protein R.SK#ASLNPNDLGPLPPGWEER. Uncharacterized protein R.GSSQPNLSTSYSEQEYGK#AGGSPASYHGSTSP Uncharacterized protein K.DFQYIDRDGK#DQGINVR.E Uncharacterized protein K.QLVALLK#DEER.L Uncharacterized protein K.DFLK#EFNNK.T Uncharacterized protein K.RYIPETLNK#SIR.Q Uncharacterized protein R.SK#QGAEWMSPNQENK.Q Uncharacterized protein R.SPSIDSIQK#DPR.E Uncharacterized protein R.K#IQLHSSQVLR.N Uncharacterized protein R.GTIPDMIADSSK#YIK.L R.GTIPDM%IADSSK#YIK.L Uncharacterized protein Uncharacterized protein K.FVLK#NYGENPEAYNEELK.K Uncharacterized protein R.TQDQLPAYPEK#NASEGAVR.L Uncharacterized protein R.RVLDDAVELSQDHFK#K.Y K.AIAHYEQSADYYK#GEESNSSANK.C Uncharacterized protein Uncharacterized protein K.HDSATSFVDAGNAYK#K.A Uncharacterized protein K.SIQGDGEGDGDLK#.Uncharacterized protein K.K#SIQGDGEGDGDLK.Uncharacterized protein (Fragment R.HK#LANPPPMVEGEGLASR.L Uncharacterized protein (Fragment K.RHK#LANPPPMVEGEGLASR.L Uncharacterized protein (Fragment R.AGNLDK#VVEYLK.G Uncharacterized protein (Fragment K.GFTPLHVAAK#YGSLDVAK.L Uncharacterized protein (Fragment K.ILGNK#ATFSPIVTLEPR.R Uncharacterized protein (Fragment R.K#SSLPNSK.E Uncharacterized protein (Fragment R.QLQLELK#NLR.N Uncharacterized protein (Fragment K.TEEDPK#LFQSIK.T Uncharacterized protein (Fragment K.VPSEK#ILR.A Uncharacterized protein (Fragment K.RLK#SSTSFANIQENST.Uncharacterized protein (Fragment K.LSQNK#QAVEGLGDLK.L Uncharacterized protein (Fragment R.ELK#PMASGASSA.Uncharacterized protein (Fragment K.ENVPSEK#ILR.A Uncharacterized protein (Fragment K.K#VYEGGNNVDQFVTR.F Uncharacterized protein (Fragment R.ELLSAK#DAR.G R.YSLAEK#ILR.D Uncharacterized protein (Fragment Uncharacterized protein (Fragment K.IIYNNLGIDEGAWMK#R.L K.GTILISSEEGETEANNPK#K.L Uncharacterized protein (Fragment Uncharacterized protein (Fragment K.LTFYALSAPEK#LDR.I K.TNMEK#LTFYALSAPEK.L Uncharacterized protein (Fragment Uncharacterized protein (Fragment R.LEEEEKSLDEEK#K.Q Uncharacterized protein (Fragment K.ENMLK#YPELYK.T Uncharacterized protein (Fragment K.TDDVSEK#TSLADQEEVR.T Uncharacterized protein (Fragment K.VNVGDIVIIK#GK.E Uncharacterized protein (Fragment K.VLASNPIMESIGNAK#TTR.N Uncharacterized protein (Fragment R.SQLVSQK#EAIQPK.N Uncharacterized protein (Fragment R.LQLSEEEAK#VATGR.V Uncharacterized protein (Fragment K.VLASNPIM%ESIGNAK#TTR.N Uncharacterized protein (Fragment K.ALSEK#SAPEVTAPGAPAYR.V Uncharacterized protein (Fragment R.VASALPGMENVQEK#SK.E Uncharacterized protein (Fragment R.AQTMANSGIK#.Uncharacterized protein (Fragment K.GADDAADADTAIINAEGGQNNSEEK#K.E Uncharacterized protein (Fragment R.DLSK#PIGALNPK.R Uncharacterized protein (Fragment K.LMDITDIQK#YK.V Uncharacterized protein (Fragment K.LM%DITDIQK#YK.V Uncharacterized protein (Fragment R.RIELEQK#MQEVLK.A Uncharacterized protein (Fragment K.AYYIAK#EVSTTER.T Uncharacterized protein (Fragment R.LGSLSK#LSGK.G Uncharacterized protein (Fragment R.YGYK#EVVLK.G Uncharacterized protein (Fragment R.AGPVAVAPELESK#ESVL.Uncharacterized protein (Fragment K.KGEQELQEVK#VEAIPNSK.S Uncharacterized protein (Fragment R.K#LFFTTANAHFK.V Uncharacterized protein (Fragment R.LYQQIK#AGAYDFPSPEWDTVTPEAK.D Uncharacterized protein (Fragment K.AVGNADGDWAVATLK#SPK.A Uncharacterized protein (Fragment K.AK#AAALAAAAADAPQR.A Uncharacterized protein (Fragment K.LGLDEYLDK#LK.H Uncharacterized protein (Fragment R.YIQEQNEK#VFAPR.G Uncharacterized protein (Fragment R.SK#HLGEELQGYWDK.E Uncharacterized protein (Fragment K.NFGIGQDLQPK#R.D Uncharacterized protein (Fragment R.DALK#GGEGR.S Uncharacterized protein (Fragment K.K#KGEVDNEEGR.E Uncharacterized protein (Fragment R.ESHTMK#LGPLEEK#R.I Uncharacterized protein (Fragment R.ASTIFLSK#SQTDVR.E Uncharacterized protein (Fragment R.LIFAGK#QPEDGR.L Uncharacterized protein (Fragment K.TIMLEVEPSDTIEDVK#AK.I Uncharacterized protein (Fragment R.TK#LQNESGEFFK.R Uncharacterized protein (Fragment K.VDSTK#EDDLAELK.T Uncharacterized protein (Fragment K.NAK#LVER.L Uncharacterized protein (Fragment R.EK#TDAHFVDVIK.E R.ASYQEEVIK#NSPVK.T Uncharacterized protein (Fragment Uncharacterized protein (Fragment K.ELEEGK#AAYLK.D K.VSNDIIQSK#EDDIKA.Uncharacterized protein (Fragment Uncharacterized protein (Fragment R.SK#LLSPYSPQTQETDSTGQK.E Uncharacterized protein (Fragment K.LLSPYSPQTQETDSTGQK#ER.N R.SLGYAYVNYQQPVDAK#R.A Uncharacterized protein (Fragment Uncharacterized protein (Fragment K.GYGFVHFQK#QESAER.A Uncharacterized protein (Fragment K.LNDPFQPFPGNDSPK#EK.D Uncharacterized protein (Fragment K.AQLEEQLK#EVR.K R.GSSLPGK#PSSPHSGQDPPAPPVD.Uncharacterized protein C4orf34 homolog Uncharacterized protein KIAA1539 homolog R.ALK#RPAPSTEGPR.E UPF0452 protein C7orf41 homolog K.K#TLQEVLEK.V UPF0696 protein C11orf68 homolog R.LQVAK#VSPR.A Urea transporter 1 R.MPLSK#VTYSEENR.I Vacuolar protein sorting 36 K.NSYIK#LSFK.E Vacuolar protein sorting-associated protein 26A K.YEIM%DGAPVK#GESIPIR.L Vacuolar protein sorting-associated protein 26A K.YEIMDGAPVK#GESIPIR.L R.VPGISK#DLR.E Vacuolar protein sorting-associated protein 45 Vacuolar protein sorting-associated protein 45 K.LK#ENLYPYLGPSTLR.D Vacuolar protein sorting-associated protein 52 homol R.AADDSK#EVESFQQLLNAR.T Vang-like protein 2 K.LSEEFVDPK#SHK.F R.VAILK#ANLR.K VCP/p97 VCP/p97 K.SPVAK#DVDLEFLAK.M VCP/p97 R.ELQELVQYPVEHPDK#FLK.F -.A]SGADSK#GDDLSTAILK.Q VCP/p97 VCP/p97 K.AIGVK#PPR.G R.HPALFK#AIGVKPPR.G VCP/p97 VCP/p97 R.VINQILTEM%DGMSTK#K.N K.SRVAILK#ANLR.K VCP/p97 VCP/p97 R.VINQILTEMDGM%STK#K.N R.VINQILTEMDGMSTK#K.N VCP/p97 Vesicle-associated membrane protein 1 R.DQK#LSELDDRADALQAGASVFESSAAK.L Vesicle-associated membrane protein 3 R.VNVDK#VLER.D Vesicle-associated membrane protein 3 R.DQK#LSELDDRADALQAGASQFETSAAK.L Vesicle-associated membrane protein 3 R.DQK#LSELDDR.A Vesicle-associated membrane protein 3 R.ADALQAGASQFETSAAK#LK.R Vesicle-associated membrane protein 3 K.LSELDDRADALQAGASQFETSAAK#LK.R Vesicle-associated membrane protein 3 K.VLERDQK#LSELDDR.A Vesicle-associated membrane protein 3 R.ADALQAGASQFETSAAKLK#R.K Vesicle-associated membrane protein 7 K.TENLVDSSVTFK#TTSR.N Vesicle-associated membrane protein 7 R.VTETQAQVDELK#GIMVR.N Vesicle-associated membrane protein 7 R.VTETQAQVDELK#GIM%VR.N Vesicular glutamate transporter 1 R.K#YIEDAIGESAK.L Vesicular glutamate transporter 1 K.YIEDAIGESAK#LMNPVTK.F Vesicular glutamate transporter 1 K.YIEDAIGESAK#LM%NPVTK.F Vesicular glutamate transporter 1 R.KYIEDAIGESAK#LMNPVTK.F R.K#YIEDAIGESAK#LMNPVTK.F Vesicular glutamate transporter 1 Vesicular glutamate transporter 2 K.K#EEFVQESAQDAYSYK.D Vimentin R.K#LLEGEESR.I R.QVDQLTNDK#AR.V Vimentin

2.636 2.636 2.636 2.477 1.902 1.902 1.955 1.955 4.237 2.875 2.875 2.875 2.12 2.12 2.794 2.033 2.033 2.838 2.838 3.336 2.581 2.401 2.354 2.354 2.354 2.354 3.726 3.726 2.815 2.815 2.815 2.151 1.565 2.357 2.075 2.35 2.718 1.62 1.856 3.091 2.05 2.027 3.662 2.246 2.835 2.835 2.277 2.619 2.619 2.619 2.714 2.714 2.714 2.714 2.714 3.233 2.158 2.729 2.858 1.832 1.832 1.832 2.716 2.716 1.975 3.071 3.071 2.472 5.809 3.175 3.372 2.542 2.514 2.436 3.046 1.697 1.908 2.315 2.795 1.77 1.77 2.095 2.015 2.015 2.645 2.645 3.128 3.128 2.477 2.477 2.501 2.501 2.497 2.497 2.495 1.781 3.483 2.423 2.669 2.241 2.454 2.454 2.596 2.596 2.502 3.039 1.884 1.884 1.884 1.884 1.884 1.884 1.884 1.884 1.884 1.884 2.925 3.365 3.365 3.365 3.365 3.365 3.365 3.365 2.495 2.495 2.495 1.889 1.889 1.889 1.889 1.889 4.141 2.344 2.344

0.407 0.407 0.407 0.091 0.498 0.498 0.197 0.197 0.652 0.674 0.674 0.674 0.118 0.118 0.333 0.176 0.176 0.07 0.07 0.73 0.404 0.012 0.367 0.367 0.367 0.367 0.427 0.427 0.294 0.294 0.294 0.202 0.192 0.595 0.276 0.447 0.298 0.399 0.272 0.302 0.219 0.469 0.383 0.11 0.363 0.363 0.152 0.314 0.314 0.314 0.187 0.187 0.187 0.187 0.187 0.62 0.561 0.321 0.444 0.126 0.126 0.126 0.269 0.269 0.26 0.331 0.331 0.579 0.71 0.177 0.386 0.131 0.408 0.52 0.427 0.211 0.2 0.061 0.164 0.237 0.237 0.228 0.294 0.294 0.586 0.586 0.433 0.433 0.641 0.641 0.339 0.339 0.291 0.291 0.586 0.053 0.155 0.449 0.419 0.33 0.171 0.171 0.147 0.147 0.233 0.188 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.182 0.026 0.026 0.026 0.026 0.026 0.026 0.026 0.579 0.579 0.579 0.456 0.456 0.456 0.456 0.456 0.493 0.255 0.255

3 3 3 3 3 3 3 3 3 2 2 2 3 3 3 3 3 3 3 3 3 2 3 3 3 3 3 3 3 3 3 2 3 3 2 3 3 2 2 3 2 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 3 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 2 2 2 3 3 3 3 3 2 2 3 3 2 2 3 3 3 3 3 3 3 3 3 2 3 2 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4 4 4 4 4 3 3 3 3 3 3 3 3 3 3 3

478.2847 478.2847 478.2847 601.6262 564.9203 564.9203 600.9557 600.9557 764.387 714.3965 714.3965 714.3965 423.5473 423.5473 616.6159 474.9437 474.9437 590.297 590.297 757.6997 730.0262 1007.5197 511.5771 511.5771 511.5771 511.5771 725.0476 725.0476 657.3741 657.3741 657.3741 487.766 456.9361 516.9343 528.3137 632.9852 571.975 631.8078 649.8571 613.9709 558.8039 603.8454 669.6754 711.0205 652.9959 652.9959 573.9463 456.9455 456.9455 456.9455 677.0168 677.0168 677.0168 677.0168 677.0168 601.3074 567.7835 906.742 683.8879 749.3856 749.3856 749.3856 552.3245 552.3245 606.8354 714.0464 714.0464 513.6078 990.1519 638.6608 527.6212 474.2607 579.2963 601.9596 743.8914 508.7594 687.8351 628.3193 556.297 482.2569 482.2569 514.5923 472.2694 472.2694 505.9322 505.9322 682.8562 682.8562 793.7177 793.7177 632.9701 632.9701 486.2623 486.2623 775.7102 498.6105 401.2311 556.3326 556.6058 607.3326 663.6743 663.6743 626.6758 626.6758 712.351 510.5935 646.6602 646.6602 646.6602 646.6602 646.6602 646.6602 646.6602 646.6602 646.6602 646.6602 734.8619 545.037 545.037 545.037 545.037 545.037 545.037 545.037 683.0197 683.0197 683.0197 703.6881 703.6881 703.6881 703.6881 703.6881 679.3129 562.9698 562.9698


5 3 1 1 5 1 1 1 4 4 2 1 1 1 1 24 7 5 4 2 5 1 6 2 2 1 4 2 5 2 1 2 1 1 3 1 4 1 4 1 2 3 1 1 6 2 1 2 2 1 4 4 3 2 1 1 3 5 2 5 1 1 3 2 1 2 1 1 7 3 21 1 1 1 7 1 1 1 1 1 1 1 6 2 2 2 2 2 4 2 9 1 4 1 1 1 13 3 3 3 3 1 6 1 1 2 12 12 6 3 2 2 1 1 1 1 1 43 11 9 7 5 3 1 14 5 3 30 2 1 1 1 1 4 3

30 30 30 1 6 6 2 2 4 7 7 7 2 2 1 31 31 9 9 2 5 1 11 11 11 11 6 6 8 8 8 2 1 1 3 1 4 1 4 1 2 3 1 1 8 8 1 5 5 5 14 14 14 14 14 1 3 5 2 7 7 7 5 5 1 3 3 1 7 3 21 1 1 1 7 1 1 1 1 2 2 1 8 8 4 4 4 4 6 6 10 10 5 5 1 1 13 3 3 3 4 4 7 7 1 2 41 41 41 41 41 41 41 41 41 41 1 79 79 79 79 79 79 79 22 22 22 35 35 35 35 35 1 10 10

K207 K207 K247 K1009 K41 K1088 K320 K2020 K423 K188 K117 K135 K249 K227 K851 K453 K616 K338 K338 K32 K1218 K912 K153 K93 K298 K285 K967 K967 K19 K545 K1153 K775 K471 K136 K28 K117 K193 K634 K10 K125 K1042 K526 K3278 K504 K49 K38 K1387 K891 K11 K144 K210 K1277 K979 K210 K1232 K161 K281 K380 K2155 K542 K542 K144 K492 K715 K15 K527 K492 K1855 K27 K64 K167 K316 K112 K33 K74 K71 K124 K553,K560 K24 K54 K33 K1285 K195 K358 K159 K209 K756 K830 K14 K32 K57 K138 K805 K402 K83 K67 K80 K159 K361 K107 K242 K242 K257 K483 K584 K507 K658 K668 K502 K8 K236 K231 K614 K658 K614 K614 K61 K39 K46 K46 K70 K70 K46 K72 K172 K137 K137 K272 K283 K283 K283 K272,K283 K561 K402 K168


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P31000 P31000 P31000 P85972 P62762 P62762 P62762 P62762 Q9Z2L0 Q9Z2L0 Q9Z2L0 Q9Z2L0 Q9R1Z0 Q9R1Z0 Q9R1Z0 Q9R1Z0 Q8VHW5 P22002 P22002 Q02294 Q02294 P62483 P62483 P62483 P62483 P62483 P62483 P25286 P25286 P25286 P25286 P25286 P62815 P62815 P62815 Q6PCU2 Q5RKI0 Q5BJU7 Q5BJU7 O54975 Q71LX6 Q8VIL3 Q8VIL3

Vimentin R.LREK#LQEEMLQR.E Vimentin K.RTLLIK#TVETR.D Vimentin R.ETNLESLPLVDTHSK#R.T Vinculin K.NSK#NQGIEEALK.N Visinin-like protein 1 K.NK#DDQITLDEFK.E Visinin-like protein 1 K.QNSK#LAPEVMEDLVK.S Visinin-like protein 1 R.VDK#IFSK.M Visinin-like protein 1 K.STEFNEHELK#QWYK.G Voltage-dependent anion-selective channel protein K.NVNAGGHK#LGLGLEFQA.Voltage-dependent anion-selective channel protein R.DVFTK#GYGFGLIK.F Voltage-dependent anion-selective channel protein -.A]VPPTYADLGK#SAR.D Voltage-dependent anion-selective channel protein K.TK#SENGLEFTSSGSANTETTK.V Voltage-dependent anion-selective channel protein K.NFNAGGHK#VGLGFELEA.Voltage-dependent anion-selective channel protein K.LTVDTIFVPNTGK#K.S Voltage-dependent anion-selective channel protein K.AAK#DVFNK.G Voltage-dependent anion-selective channel protein K.DVFNK#GYGFGMVK.I Voltage-dependent calcium channel gamma-8 subun R.SDLLK#AGGGAGGSGGSGPSAILR.L Voltage-dependent L-type calcium channel subunit a R.QAK#LM%GSAGNATISTVSSTQR.K Voltage-dependent L-type calcium channel subunit a R.QAK#LMGSAGNATISTVSSTQR.K Voltage-dependent N-type calcium channel subunit aR.K#EISSVWANLPQK.T Voltage-dependent N-type calcium channel subunit aK.K#EAEADDVLR.R Voltage-gated potassium channel subunit beta-2 K.LK#ELQAIAER.L Voltage-gated potassium channel subunit beta-2 K.AEVVLGNIIK#K.K Voltage-gated potassium channel subunit beta-2 K.IFWGGK#AETER.G Voltage-gated potassium channel subunit beta-2 R.ASLK#GYQWLK.D Voltage-gated potassium channel subunit beta-2 R.NLGK#SGLR.V Voltage-gated potassium channel subunit beta-2 K.HIIEGLK#ASLER.L V-type proton ATPase 116 kDa subunit a isoform 1 R.K#EMASGVNTR.I V-type proton ATPase 116 kDa subunit a isoform 1 K.K#HLGTLNFGGIR.V V-type proton ATPase 116 kDa subunit a isoform 1 R.K#ANIPIMDTGENPEVPFPR.D V-type proton ATPase 116 kDa subunit a isoform 1 R.VLQAAAK#NIR.V V-type proton ATPase 116 kDa subunit a isoform 1 R.MQTNQTPPTYNK#TNK.F V-type proton ATPase subunit B, brain isoform K.FEK#NFITQGPYENR.T V-type proton ATPase subunit B, brain isoform K.AVVQVFEGTSGIDAK#K.T V-type proton ATPase subunit B, brain isoform R.VFNGSGK#PIDR.G V-type proton ATPase subunit E 1 R.K#QDFPLVK.A WD repeat-containing protein 1 R.DYSGQGVVK#LDVQPK.C Wiskott-Aldrich syndrome protein family member 1 R.EQEAK#HER.I Wiskott-Aldrich syndrome protein family member 1 R.KVEEQREQEAK#HER. Xaa-Pro aminopeptidase 1 R.IENVVLVVPAK#TK.Y Xin actin-binding repeat-containing protein 2 K.K#EETIHGDVRGTR.W K.LQLAQK#QWVLQQK.R ZW10 interactor ZW10 interactor K.AFEQLEAK#K.R

2.344 2.344 2.344 2.56 3.23 3.23 3.23 3.23 3.453 3.453 3.453 3.453 2.258 2.258 2.258 2.258 5.166 2.298 2.298 2.396 2.396 1.976 1.976 1.976 1.976 1.976 1.976 2.321 2.321 2.321 2.321 2.321 1.716 1.716 1.716 2.49 1.825 2.131 2.131 2.389 2.505 1.875 1.875

0.255 0.255 0.255 0.331 0.228 0.228 0.228 0.228 0.486 0.486 0.486 0.486 0.178 0.178 0.178 0.178 0.481 0.569 0.569 0.333 0.333 0.309 0.309 0.309 0.309 0.309 0.309 0.274 0.274 0.274 0.274 0.274 0.284 0.284 0.284 0.274 0.157 0.37 0.37 0.018 0.208 0.076 0.076

3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 3 3 3 2 2 2 2 2 2 2 2 3 3 3 3 3 3 3 3 3 3 2 2 3 4 2 2

562.9698 562.9698 562.9698 482.2514 651.6414 651.6414 651.6414 651.6414 768.3583 768.3583 768.3583 768.3583 788.3857 788.3857 788.3857 788.3857 700.366 741.3777 741.3777 630.3142 630.3142 479.7753 479.7753 479.7753 479.7753 479.7753 479.7753 399.907 399.907 399.907 399.907 399.907 435.231 435.231 435.231 363.5417 582.9718 570.7729 570.7729 508.6429 403.7104 589.3139 589.3139


Page 48 of 60 1 1 1 1 7 3 2 1 39 5 3 1 19 8 2 1 15 3 2 2 1 10 9 7 4 2 2 3 2 2 1 1 15 7 1 2 1 1 1 11 1 6 2

10 10 10 1 13 13 13 13 48 48 48 48 30 30 30 30 15 5 5 3 3 34 34 34 34 34 34 9 9 9 9 9 23 23 23 2 1 2 2 11 1 8 8

K188 K445 K439 K219 K162 K7 K153 K28 K274 K20 K12 K34 K274 K109 K15 K20 K243 K93 K93 K1823 K1107 K290 K104 K124 K268 K44 K141 K255 K667 K74 K288 K366 K460 K108 K137 K138 K405 K523 K523 K546 K1109 K176 K163

Page 49 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60


Table S2: The list of conserved GG peptides that are identical or homologous to reported human GG sites. The identified rat GG peptides were aligned with previously reported GG peptides (merged data in two papers: Kim et al. Mol Cell 2011, 44:325-40, and Wagner et al. Mol Cell Proteomics 2011, 10:M111.013284). Matched AA% = 100*(matched AA # of a rat peptide/total AA # of the rat peptide). The list is sorted by matched AA%, protein name and then by GG peptides. "#": GG modification; "]": acetylation; "$": phosphorylation;"%": oxidation;"@": deamidation. Homologous peptides were also manually validated to confirm that the two peptides were derived from the same family of proteins. Rat Human Accession #

Protein Name

P62260 P62260 P62260 P62260 P62260 P62260 P68511 P68511 P61983 P61983 P61983 P61983 P63102 P68255 P68255 P63102 P63102 P63102 P63102 P63102 P63102 P63102 P63102 P63102 P63102 P46462 P62193 P62193 Q63569 Q63569 Q63569 Q63347 Q63347 G3V6W6 G3V6W6 D4AEH3 P38983 D4A1S3 P63245 D3ZB32 D3ZB32 P63326 P63326 P63326 P27952 P60868 P05765 P62909 P62243 E9PSZ5 D4ACB8 D4ACB8 P12001 P84100 P84100 P84100 P62752 P83732 P61354 P21531 P21531 P62890 P17077 B2RZ13 P35559 Q5XIE0 P60711 P60711 P60711 P60711 P60711 P60711 P60711 P60711 Q5M7U6 Q99PD4 P07308 P21932 P10824 O08697 Q5XI97 Q9Z1P2 F8WFM2 Q5XIF6 P63003 P63003 Q5U313

14-3-3 protein epsilon DNLTLWTSDMQGDGEEQNK#EA IPI:IPI00000816.1 14-3-3 protein epsilon HLIPAANTGESK#VFYYK IPI:IPI00000816.1 14-3-3 protein epsilon IISSIEQK#EENK IPI:IPI00000816.1 14-3-3 protein epsilon K#EAAENSLVAYK IPI:IPI00000816.1 14-3-3 protein epsilon MK#GDYHR IPI:IPI00000816.1 14-3-3 protein epsilon YLAEFATGNDRK#EAAENSLVAYKIPI:IPI00000816.1 14-3-3 protein eta YLAEVASGEK#K IPI:IPI00216319.3 14-3-3 protein eta VISSIEQK#TMADGNEK IPI00216319 14-3-3 protein gamma RATVVESSEK#AYSEAHEISK IPI:IPI00220642.7 14-3-3 protein gamma VISSIEQK#TSADGNEK IPI:IPI00220642.7 14-3-3 protein gamma YLAEVATGEK#R IPI:IPI00220642.7 14-3-3 protein gamma EQLVQK#AR IPI00220642 IPI00021263 14-3-3 protein zeta/delta, KCIPMK#GDYYR 14-3-3 protein theta TELIQK#AK IPI:IPI00018146.1 14-3-3 protein theta VISSIEQK#TDTSDK IPI:IPI00018146.1 14-3-3 protein zeta/delta, KCIPAK#LAEQAER IPI:IPI00021263.3 IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPGIVDQSQQAYQEAFEISK#K IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPK#EMQPTHPIR IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPK#GIVDQSQQAYQEAFEISK 14-3-3 protein zeta/delta, KCIPK#GIVDQSQQAYQEAFEISKK IPI:IPI00021263.3 IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPVFYLK#MK IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPVVSSIEQK#TEGAEK 14-3-3 protein zeta/delta, KCIPYLAEVAAGDDK#K IPI:IPI00021263.3 14-3-3 protein zeta/delta, KCIPM]DK#NELVQK IPI00021263 IPI00021263 14-3-3 protein zeta/delta, KCIPNELVQK#AK VCP/p97 A]SGADSK#GDDLSTAILK IPI00022774 IPI:IPI00011126.6 Proteasome 26S subunit, ATPK#QEGTPEGLYL IPI:IPI00011126.6 Proteasome 26S subunit, ATPSK#VDDLR Proteasome 26S subunit, ATPDAFALAK#EK IPI:IPI00018398.4 IPI:IPI00018398.4 Proteasome 26S subunit, ATPLK#PGDLVGVNK Proteasome 26S subunit, ATPLLDSEIK#IMK IPI:IPI00018398.4 Proteasome 26S subunit, ATPIATEK#DFLEAVNK IPI:IPI00021435.3 IPI:IPI00021435.3 Proteasome 26S subunit, ATPIINADSEDPK#YIINVK RCG61291 LLEHK#EIDGR IPI:IPI00021926.4 RCG61291 VVSSSIVDK#YIGESAR IPI:IPI00021926.4 Proteasome 26S subunit, rpn8DIK#DTTVGTLSQR IPI:IPI00019927.2 40S ribosomal protein SA AVLK#FAAATGATPIAGR IPI:IPI00413108.4 Uncharacterized protein LIVNK#NAGETLLQR IPI:IPI00645341.1 IPI:IPI00641950.4 Guanine nucleotide-binding prIIVDELK#QEVISTSSK Protein Epb41l3 DAENQK#NWLDPAK IPI00215716 Protein Epb41l3 ELEDK#VIELHK IPI00215716 40S ribosomal protein S10 K#AEAGAGSATEFQFR IPI:IPI00008438.1 40S ribosomal protein S10 RSAVPPGADK#K IPI:IPI00008438.1 40S ribosomal protein S10 SAVPPGADK#K IPI:IPI00008438.1 40S ribosomal protein S2 SPYQEFTDHLVK#THTR IPI:IPI00013485.3 40S ribosomal protein S20 DTGK#TPVEPEVAIHR IPI:IPI00012493.1 40S ribosomal protein S21 ADGIVSK#NF IPI:IPI00017448.1 40S ribosomal protein S3 KPLPDHVSIVEPK#DEILPTTPISEQIPI:IPI00011253.3 40S ribosomal protein S8 GAK#LTPEEEEILNK IPI:IPI00216587.9 Uncharacterized protein SSLLTEK#LLR IPI:IPI00179298.5 Chaperonin subunit 8 (Theta) ETEGDVTSVK#DAK IPI:IPI00302925.4 Chaperonin subunit 8 (Theta) LEK#LFVTNDAATILR IPI:IPI00302925.4 60S ribosomal protein L18 ENK#TAVVVGTITDDVR IPI:IPI00215719.6 60S ribosomal protein L19 EEIIK#TLSK IPI:IPI00025329.1 60S ribosomal protein L19 K#LLADQAEAR IPI:IPI00025329.1 60S ribosomal protein L19 KEEIIK#TLSK IPI:IPI00025329.1 60S ribosomal protein L23a K#LYDIDVAK IPI:IPI00021266.1 60S ribosomal protein L24 AITGASLADIMAK#R IPI:IPI00306332.4 60S ribosomal protein L27 YSVDIPLDK#TVVNK IPI:IPI00219155.5 60S ribosomal protein L3 IYK#IGQGYLIK IPI:IPI00550021.4 60S ribosomal protein L3 LIK#NNASTDYDLSDK IPI:IPI00550021.4 60S ribosomal protein L30 SGK#YVLGYK IPI:IPI00219156.7 60S ribosomal protein L9 TILSNQTVDIPENVDITLK#GR IPI:IPI00031691.1 Gprc5b protein (Fragment) AYMENK#AFSMDEHNAALR IPI00008239 Insulin-degrading enzyme IVPIK#DIR IPI00220373 Acidic leucine-rich nuclear phoDLSTVEALQNLK#NLK IPI:IPI00165393.1 Actin, cytoplasmic DSYVGDEAQSK#R IPI:IPI00021439.1 Actin, cytoplasmic EITALAPSTMK#IK IPI:IPI00021439.1 Actin, cytoplasmic HQGVMVGMGQK#DSYVGDEAQSIPI:IPI00021439.1 Actin, cytoplasmic IK#IIAPPER IPI:IPI00021439.1 Actin, cytoplasmic IK#IIAPPERK IPI:IPI00021439.1 Actin, cytoplasmic K#DLYANTVLSGGTTMYPGIADR IPI:IPI00021439.1 Actin, cytoplasmic MQK#EITALAPSTMK IPI:IPI00021439.1 Actin, cytoplasmic VAPEEHPVLLTEAPLNPK#ANR IPI:IPI00021439.1 Actin-related protein 2 ILLTEPPMNPTK#NR IPI:IPI00005159.3 Actin-related protein 40942 coEVDEK#PASTPWGSK IPI:IPI00333068.4 Acyl-CoA desaturase 1 AEK#LVMFQR IPI:IPI00299468.3 Adenylate cyclase type 3 IEVHDQK#ER IPI:IPI00028513.3 Guanine nucleotide-binding prDLFEEK#IK IPI00337415 ADP-ribosylation factor-like pr LNIWDVGGQK#SLR IPI:IPI00003326.4 Alanyl-tRNA editing protein AaVAEVLEGK#GAGK IPI:IPI00748490.1 Alpha-actinin-1 QK#ASIHEAWTDGK IPI:IPI00013508.5 Uncharacterized protein AIAHYEQSADYYK#GEESNSSAN IPI:IPI00009253.2 Tubulin alpha-4A chain GDVVPK#DVNAAIAAIK IPI00007750 Amino-terminal enhancer of spAK#QVTAPELNSIIR IPI:IPI00395596.2 Amino-terminal enhancer of spLASEK#SEMQR IPI:IPI00395596.2 Ankyrin repeat domain 13a LTLDLMK#PK IPI:IPI00217831.4

GG peptides

Accession #

Protein Name

GG peptides

14-3-3 protein epsilon DNLTLWTSDMQGDGEEQNK#EA 14-3-3 protein epsilon HLIPAANTGESK#VFYYK 14-3-3 protein epsilon IISSIEQK#EENKGGEDKLK 14-3-3 protein epsilon K#EAAENSLVAYK 14-3-3 protein epsilon MK#GDYHR 14-3-3 protein epsilon YLAEFATGNDRK#EAAENSLVAY 14-3-3 protein eta YLAEVASGEK#K 14-3-3 protein eta;Protein AS1;VISSIEQK#TMADGNEK 14-3-3 protein gamma RATVVESSEK#AYSEAHEISK 14-3-3 protein gamma VISSIEQK#TSADGNEK 14-3-3 protein gamma YLAEVATGEK#R 14-3-3 protein gamma;14-3-3 pV]DREQLVQK#AR 14-3-3 protein sigma;Epithelial MK#GDYYR 14-3-3 protein theta TELIQK#AK 14-3-3 protein theta VISSIEQK#TDTSDK 14-3-3 protein zeta/delta AK#LAEQAER 14-3-3 protein zeta/delta GIVDQSQQAYQEAFEISK#K 14-3-3 protein zeta/delta K#EMQPTHPIR 14-3-3 protein zeta/delta K#GIVDQSQQAYQEAFEISK 14-3-3 protein zeta/delta K#GIVDQSQQAYQEAFEISKK 14-3-3 protein zeta/delta VFYLK#MK 14-3-3 protein zeta/delta VVSSIEQK#TEGAEK 14-3-3 protein zeta/delta YLAEVAAGDDK#K 14-3-3 protein zeta/delta;Protei M]DK#NELVQK 14-3-3 protein zeta/delta;Protei M]DKNELVQK#AK 15S Mg(2+)-ATPase p97 subunA]SGADSK#GDDLSTAILK 26S protease regulatory subun K#QEGTPEGLYL 26S protease regulatory subun SK#VDDLR 26S protease regulatory subun DAFALAK#EK 26S protease regulatory subun LK#PGDLVGVNK 26S protease regulatory subun LLDSEIK#IMK 26S protease regulatory subun IATEK#DFLEAVNK 26S protease regulatory subun IINADSEDPK#YIINVKQFAK 26S protease regulatory subun LLEHK#EIDGR 26S protease regulatory subun VVSSSIVDK#YIGESAR 26S proteasome non-ATPase rDIK#DTTVGTLSQR 33 kDa protein AVLK#FAAATGATPIAGR 37 kDa protein LIVNK#NAGETLLQR 38 kDa protein IIVDELK#QEVISTSSK 4.1B;Band 4.1-like protein 3;DifDAENQK#NWLDPAK 4.1B;Band 4.1-like protein 3;DifELEDK#VIELHK 40S ribosomal protein S10 K#AEAGAGSATEFQFR 40S ribosomal protein S10 RSAVPPGADK#K 40S ribosomal protein S10 SAVPPGADK#K#AEAGAGSATEF 40S ribosomal protein S2 SPYQEFTDHLVK#THTR 40S ribosomal protein S20 DTGK#TPVEPEVAIHR 40S ribosomal protein S21 ADGIVSK#NF 40S ribosomal protein S3 KPLPDHVSIVEPK#DEILPTTPISE 40S ribosomal protein S8 GAK#LTPEEEEILNK 482 kDa protein SSLLTEK#LLR 59 kDa protein ETEGDVTSVK#DAK 59 kDa protein MVINHLEK#LFVTNDAATILR 60S ribosomal protein L18 ENK#TAVVVGTITDDVR 60S ribosomal protein L19 KEEIIK#TLSK 60S ribosomal protein L19 K#LLADQAEAR 60S ribosomal protein L19 KEEIIK#TLSK 60S ribosomal protein L23a K#LYDIDVAK 60S ribosomal protein L24 AITGASLADIMAK#R 60S ribosomal protein L27 YSVDIPLDK#TVVNK 60S ribosomal protein L3 IYK#IGQGYLIK 60S ribosomal protein L3 LIK#NNASTDYDLSDK 60S ribosomal protein L30 SGK#YVLGYK 60S ribosomal protein L9 TILSNQTVDIPENVDITLK#GR A-69G12.1;G-protein coupled r AYMENK#AFSMDEHNAALR Abeta-degrading protease;Insu IVPIK#DIR Acidic leucine-rich nuclear phosDLSTVEALQNLK#NLK Actin, cytoplasmic 1 DSYVGDEAQSK#R Actin, cytoplasmic 1 EITALAPSTMK#IK Actin, cytoplasmic 1 HQGVMVGMGQK#DSYVGDEAQ Actin, cytoplasmic 1 IK#IIAPPER Actin, cytoplasmic 1 IK#IIAPPERK Actin, cytoplasmic 1 K#DLYANTVLSGGTTMYPGIADR Actin, cytoplasmic 1 MQK#EITALAPSTMK Actin, cytoplasmic 1 VAPEEHPVLLTEAPLNPK#ANR Actin-related protein 2 ILLTEPPMNPTK#NR Actin-related protein 2/3 compleEVDEK#PASTPWGSK Acyl-CoA desaturase GSTLDLSDLEAEK#LVMFQR ADCY3 protein IEVHDQK#ER Adenylate cyclase-inhibiting G DLFEEK#IK ADP-ribosylation factor-like proLNIWDVGGQK#SLR alanyl-tRNA synthetase domainVAEVLEGK#GAGK Alpha-actinin-1 QK#ASIHEAWTDGK Alpha-soluble NSF attachment AIAHYEQSADYYK#GEESNSSAN Alpha-tubulin 1;Testis-specific aGDVVPK#DVNAAIAAIK amino-terminal enhancer of spl AK#QVTAPELNSIIR amino-terminal enhancer of spl LASEK#SEMQR Ankyrin repeat domain-contain LTLDLMK#PK


Matched AA % 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q5U313 Q3B8Q0 Q3B8Q0 Q5XID7 F1LUT4 P25286 Q9ESR9 Q5RKI1 F1LT32 F1LT32 D3ZAY2 D3ZAY2 Q4KM58 P25113 Q9JKA9 P05708 P05708 XP_001075972.1 Q9Z1Y3 P63100 P62161 P62161 P62161 P12369 D4ABH0 Q5M9G3 P97633 Q62761 P41350 D4ACB8 P62483 P62483 B3GNI6 Q8CFN2 P50137 P06685 Q66HA6 B2RYG6 B3GNI6 B3GNI6 P60868 P68370 P68370 P68370 P68370 P68370 P68370 P68370 P68370 P68370 P50399 D4A4G6 Q6AYD5 B2GUW4 B2RYB8 Q6P502 Q9Z0W7 D4A3T3 P11442 G3V674 O35142 P45592 P45592 P47942 P08050 Q68FW9 Q02874 Q02874 P07335 P07335 B1WBY1 B1WBY1 Q9JJ31 F1M4U0 P60905 P60905 G3V6A1 G3V6A1 Q64654 P38650 P38650 O08651 D3ZRV0 D3ZRV0 D3ZRV0 F1M680 F1M680 F1M680 O35824 B2RYA8 NP_001013094.1 P36506 P63170 P62628

Ankyrin repeat domain 13a TDK#AEVVNGYEAK IPI:IPI00217831.4 Microtubule-associated proteinFYDANYDGK#EYDPVEAR IPI00003420 IPI00003420 Microtubule-associated proteinK#FYDANYDGK Armadillo repeat-containing X-EK#ALIVLNNLSVNAENQR IPI00009906 IPI00032402 Uncharacterized protein (Frag ENMLK#YPELYK V-type proton ATPase 116 kD VLQAAAK#NIR IPI00892784 ATP-binding cassette sub-famVSEEDQSLENSEADVK#ESR IPI:IPI00307592.6 IPI00409717 Eukaryotic initiation factor 4A- GVAINFVTEEDK#R Protein Birc6 AVDSTLK#TR IPI:IPI00299635.7 Protein Birc6 GSSYK#LLVEQAK IPI:IPI00299635.7 Protein Epb4.1l2 ELEEK#VAELHK IPI:IPI00015973.1 Protein Epb4.1l2 GLSPAQADSQFLENAK#R IPI00015973 Catenin, beta-interacting proteSPEEMYIQQK#VR IPI00514012 Phosphoglycerate mutase 1 A]AYK#LVLIR IPI00549725 Potassium/sodium hyperpolar QFGALLQPGVNK#FSLR IPI00218946 Hexokinase-1 ASGVEGADVVK#LLNK IPI00018246 Hexokinase-1 LLNK#AIK IPI00018246 PREDICTED: CG5555-like LVASK#TDGK IPI00396089 Cadherin-2 QAK#QLLIDPEDDVRDNILK IPI00290085 Calcineurin subunit B type 1 MMVGNNLK#DTQLQQIVDK IPI:IPI00027464.8 Calmodulin DGDGTITTK#ELGTVMR IPI:IPI00075248.1 Calmodulin EAFSLFDK#DGDGTITTK IPI:IPI00075248.1 Calmodulin VFDK#DGNGYISAAELR IPI:IPI00075248.1 cAMP-dependent protein kina GQYFGELALVTNK#PR IPI00554752 Uncharacterized protein GGETPGSEQWK#FQELSQPR IPI00745406 Caprin-1 YQEVTNNLEFAK#ELQR IPI00783872 Casein kinase I isoform alpha A]SSSGSK#AEFIVGGK IPI00448798 IPI00218437 Casein kinase I isoform gammGSLPWQGLK#ADTLK Caveolin-1 S]GGK#YVDSEGHLYTVPIR IPI00009236 Chaperonin subunit 8 (Theta) A]LHVPK#APGFAQMLK IPI00784090 IPI00442307 Voltage-gated potassium chanASLK#GYQWLK IPI00442307 Voltage-gated potassium chanLK#ELQAIAER Septin-11 DTDPDSK#PFSLQETYEAK IPI:IPI00019376.7 Cell division control protein 42QK#PITPETAEK IPI00909484 Transketolase K#ILATPPQEDAPSVDIANIR IPI00643920 Sodium/potassium-transportin EVSMDDHK#LSLDELHR IPI00646182 ADP-ribosylation factor-like pr DLPNALDEK#QLIEK IPI:IPI00018871.2 Ubiquitin thioesterase OTUB1 EYAEDDNIYQQK#IK IPI:IPI00000581.6 Septin-11 LDSK#VNIIPIIAK IPI00550119 Septin-11 RNEFLGELQK#K IPI00550119 40S ribosomal protein S20 A]FK#DTGK IPI00794659 Tubulin, alpha chain DVNAAIATIK#TK IPI:IPI00792677.1 Tubulin, alpha chain DVNAAIATIK#TK#R IPI:IPI00792677.1 Tubulin, alpha chain FDLMYAK#R IPI:IPI00792677.1 Tubulin, alpha chain GDVVPK#DVNAAIATIK IPI:IPI00792677.1 Tubulin, alpha chain LDHK#FDLMYAK IPI:IPI00792677.1 Tubulin, alpha chain LSVDYGK#K IPI:IPI00792677.1 Tubulin, alpha chain QLFHPEQLITGK#EDAANNYAR IPI:IPI00792677.1 Tubulin, alpha chain TIGGGDDSFNTFFSETGAGK#HV IPI:IPI00792677.1 Tubulin, alpha chain VGINYQPPTVVPGGDLAK#VQR IPI:IPI00792677.1 Rab GDP dissociation inhibito YIAIVSTTVETK#EPEK IPI:IPI00031461.2 Uncharacterized protein SAFPFSDK#LGELSDK IPI:IPI00291930.6 G1 to S phase transition 1 KGEFETGFEK#GGQTR IPI00910513 Exdl2 protein QQLAK#EFQAPIGSEEGLR IPI00465113 Integrin beta SQWNNDNPLFK#SATTTVMNPK IPI00291792 T-complex protein 1 subunit g GASK#EILSEVER IPI:IPI00290770.3 Chloride intracellular channel LHIVK#VVAK IPI00001960 RCG35120, isoform CRA_a NSDEADLVPAK#EANVK IPI:IPI00010320.1 Clathrin heavy chain 1 QLLEK#WLK IPI00024067 Claudin domain containing 1, EYTLMK#AYR IPI00746431 Coatomer subunit beta' DFSMADK#VLPTIPK IPI:IPI00220219.6 Cofilin-1 K#NIILEEGK IPI:IPI00012011.6 Cofilin-1 YALYDATYETK#ESK IPI:IPI00012011.6 Dihydropyrimidinase-related p K#PFPDFVYK IPI00257508 Gap junction alpha-1 protein NYNK#QASEQNWANYSAEQNR IPI00218487 IPI:IPI00025721.3 COP9 signalosome complex sLK#AMDQEITVNPQFVQK Histone H2A GVTIASGGVLPNIHPELLAK#KR IPI00304171 Histone H2A GVTIASGGVLPNIHPELLAKK#R IPI00304171 Creatine kinase B-type FSEVLK#R IPI:IPI00022977.1 Creatine kinase B-type VISMQK#GGNMK IPI:IPI00022977.1 Cullin 1 FINNNAVTK#MAQSSSK IPI:IPI00014310.3 Cullin 1 VDGEK#DTYSYLA IPI:IPI00014310.3 Cullin 5 TQEAIIQIMK#MR IPI:IPI00216003.4 Uncharacterized protein (Frag ASTIFLSK#SQTDVR IPI00871180 DnaJ homolog subfamily C meFK#EINNAHAILTDATK IPI00402231 DnaJ homolog subfamily C meNPDNPEAADK#FK IPI00402231 Cysteine-rich hydrophobic domRSIEK#LLEWENNR IPI:IPI00015878.1 Cysteine-rich hydrophobic domSIEK#LLEWENNR IPI:IPI00015878.1 Lanosterol 14-alpha demethyl YLQDNPASGEK#FAYVPFGAGR IPI:IPI00295772.5 Cytoplasmic dynein 1 heavy c SLLQALNEVK#GR IPI:IPI00456969.1 Cytoplasmic dynein 1 heavy c DLPPVSGSIIWAK#QIDR IPI00456969 D-3-phosphoglycerate dehydr SATK#VTADVINAAEK IPI:IPI00011200.5 DCN1, defective in cullin neddAQIPK#MEQELK IPI:IPI00291893.4 DCN1, defective in cullin neddK#LEQLYNR IPI:IPI00291893.4 DCN1, defective in cullin neddMEQELK#EPGR IPI:IPI00291893.4 DNA damage-binding protein IVVFQYSDGK#LQTVAEK IPI:IPI00293464.5 DNA damage-binding protein LQTVAEK#EVK IPI:IPI00293464.5 DNA damage-binding protein MQEVVANLQYDDGSGMK#R IPI:IPI00293464.5 DnaJ homolog subfamily A meEISFAYEVLSNPEK#R IPI:IPI00032406.1 LOC689593 protein EVAEAYEVLSDK#HK IPI00220102 dnaJ homolog subfamily B meEIYDQFGEEGLK#GGAGGTDGQGIPI:IPI00003848.1 IPI:IPI00003783.1 Dual specificity mitogen-activaDVK#PSNILVNSR Dynein light chain 1, cytoplasmYNIEK#DIAAHIK IPI:IPI00019329.1 Dynein light chain roadblock-tyA]EVEETLK#R IPI00412497

Ankyrin repeat domain-contain TDK#AEVVNGYEAK APC-binding protein EB2;End-bFYDANYDGK#EYDPVEAR APC-binding protein EB2;End-bK#FYDANYDGKEYDPVEAR ARM protein lost in epithelial caEK#ALIVLNNLSVNAENQR ATPase class I type 8A membeENMLK#YPELYK ATPase, H+ transporting, lysosVLQAAAK#NIR ATP-binding cassette, sub-fam VSEEDQSLENSEADVK#ESR ATP-dependent RNA helicase KGVAINFVTEEDK#R baculoviral IAP repeat-containi AVDSTLK#TR baculoviral IAP repeat-containi GSSYK#LLVEQAK Band 4.1-like protein 2 ELEEK#VAELHK Band 4.1-like protein 2;Genera GLSPAQADSQFLENAK#R Beta-catenin-interacting proteinSPEEMYIQQK#VR BPG-dependent PGAM 1;PhosA]AYK#LVLIR Brain cyclic nucleotide-gated chQFGALLQPGVNK#FSLR Brain form hexokinase;HexokinASGVEGADVVK#LLNK Brain form hexokinase;HexokinLLNK#AIK BRAP2;BRCA1-associated pro LVASK#TDGK#IVQYECEGDTCQ Cadherin-2;CDw325;Neural ca QAK#QLLIDPEDDVRDNILK Calcineurin subunit B type 1 MMVGNNLK#DTQLQQIVDK Calmodulin DGDGTITTK#ELGTVMR Calmodulin EAFSLFDK#DGDGTITTK Calmodulin VFDK#DGNGYISAAELR cAMP-dependent protein kinas GQYFGELALVTNK#PR Cancer/testis antigen 89;C-Jun GGETPGSEQWK#FQELSQPR Caprin-1;Cell cycle-associated YQEVTNNLEFAK#ELQR Casein kinase I isoform alpha;CA]SSSGSK#AEFIVGGK Casein kinase I isoform gammaGSLPWQGLK#ADTLK Caveolin-1;Caveolin;Caveolin;CS]GGK#YVDSEGHLYTVPIR CCT-theta;Renal carcinoma anA]LHVPK#APGFAQMLK cDNA FLJ16180 fis, clone BRHASLK#GYQWLK cDNA FLJ16180 fis, clone BRHLK#ELQAIAER cDNA FLJ53374, highly similar DTDPDSK#PFSLQETYEAK cDNA FLJ54776, highly similar QK#PITPETAEK#LAR cDNA FLJ54957, highly similar K#ILATPPQEDAPSVDIANIR cDNA FLJ55427, highly similar EVSMDDHK#LSLDELHR cDNA FLJ56285, highly similar DLPNALDEK#QLIEK cDNA FLJ56307, highly similar EYAEDDNIYQQK#IK cDNA FLJ58821, highly similar LDSK#VNIIPIIAK cDNA FLJ58821, highly similar RNEFLGELQK#KEEEMR cDNA FLJ58953, highly similar A]FK#DTGKTPVEPEVAIHR cDNA FLJ60097, highly similar DVNAAIATIK#TK cDNA FLJ60097, highly similar DVNAAIATIK#TK#R cDNA FLJ60097, highly similar FDLMYAK#R cDNA FLJ60097, highly similar GDVVPK#DVNAAIATIK cDNA FLJ60097, highly similar LDHK#FDLMYAK cDNA FLJ60097, highly similar LSVDYGK#K cDNA FLJ60097, highly similar QLFHPEQLITGK#EDAANNYAR cDNA FLJ60097, highly similar TIGGGDDSFNTFFSETGAGK#HV cDNA FLJ60097, highly similar VGINYQPPTVVPGGDLAK#VQR cDNA FLJ60299, highly similar YIAIVSTTVETK#EPEK cDNA FLJ61629, highly similar SAFPFSDK#LGELSDK cDNA FLJ78119, highly similar KGEFETGFEK#GGQTR cDNA FLJ78298;cDNA FLJ314QQLAK#EFQAPIGSEEGLR Cell surface adhesion glycopro SQWNNDNPLFK#SATTTVMNPK chaperonin containing TCP1, s GASK#EILSEVER Chloride intracellular channel p LHIVK#VVAK Chromobox protein homolog 1 NSDEADLVPAK#EANVK Clathrin heavy chain 1;Clathrin QLLEK#WLK Claudin domain-containing protEYTLMK#AYR Coatomer subunit beta' DFSMADK#VLPTIPK Cofilin-1 K#NIILEEGK Cofilin-1 YALYDATYETK#ESK Collapsin response mediator prK#PFPDFVYK Connexin-43;Gap junction 43 k NYNK#QASEQNWANYSAEQNR COP9 signalosome complex suLK#AMDQEITVNPQFVQK Core histone macro-H2A.1;HistGVTIASGGVLPNIHPELLAK#KR Core histone macro-H2A.1;HistGVTIASGGVLPNIHPELLAKK#R Creatine kinase B-type FSEVLK#R Creatine kinase B-type VISMQK#GGNMK Cullin-1 FINNNAVTK#MAQSSSK Cullin-1 VDGEK#DTYSYLA Cullin-5 TQEAIIQIMK#MR Cyclin-Y-like protein 1;Cyclin-Y ASTIFLSK#SQTDVR Cysteine string protein;DnaJ hoFK#EINNAHAILTDATK Cysteine string protein;DnaJ hoNPDNPEAADK#FK Cysteine-rich hydrophobic domRSIEK#LLEWENNR Cysteine-rich hydrophobic domSIEK#LLEWENNR cytochrome P450, family 51, suYLQDNPASGEK#FAYVPFGAGR Cytoplasmic dynein 1 heavy chSLLQALNEVK#GR Cytoplasmic dynein 1 heavy chDLPPVSGSIIWAK#QIDR D-3-phosphoglycerate dehydro SATK#VTADVINAAEK DCN1-like protein 1 AQIPK#MEQELK DCN1-like protein 1 K#LEQLYNR DCN1-like protein 1 MEQELK#EPGR DNA damage-binding protein 1 IVVFQYSDGK#LQTVAEK DNA damage-binding protein 1 LQTVAEK#EVK DNA damage-binding protein 1 MQEVVANLQYDDGSGMK#R DnaJ homolog subfamily A me EISFAYEVLSNPEK#R DnaJ homolog subfamily B me EVAEAYEVLSDK#HK DnaJ homolog subfamily B me EIYDQFGEEGLK#GGAGGTDGQ Dual specificity mitogen-activat DVK#PSNILVNSR Dynein light chain 1, cytoplasmYNIEK#DIAAHIK Dynein, light chain, roadblock-t A]EVEETLK#R


Page 50 of 60

100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100

Page 51 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

D3ZUV2 D3ZUV2 D3ZUV2 F1LRS0 Q8R5M4 Q5XIT1 O09032 Q8CH84 P0C0A2 P62630 P62630 P62630 P62630 P05197 P05197 F1MA55 F1LQ45 F1LQ45 Q5RKI1 Q1JU68 Q1JU68 Q9Z1X1 P31977 B2GUZ5 P09117 P09117 P05065 P05065 P05065 P05065 P05065 P05065 P05065 P19627 D4A5X7 D3Z8K9 Q6P6V0 Q6P6V0 P09606 P04797 P04797 P53534 G3V7G8 G3V7G8 G3V7G8 G3V7G8 Q6AYQ1 P62828 P62828 P10824 P10824 P59215 Q02874 Q02874 B1WC28 P63018 P63018 P34058 P34058 P34058 P34058 B4F7C7 P63159 P06349 P06349 P02262 D3ZXP3 P0C0S7 D3ZZP9 Q00715 Q00715 Q00715 Q00715 P84245 B0BN93 G3V8Y8 D4A781 P15127 Q4KLJ2 Q5XIE8 Q7TP98 D3Z9U0 Q63570 P51639 Q76K24 P84092 P84092 P84092 P84092 F1LPF3 P11442 P11442 P11442 P11442


E3 ligase mindbomb 1 K#LFETQESGDLNEELVK IPI:IPI00183054.1 E3 ligase mindbomb 1 LLLK#QNVDVEAEDK IPI:IPI00183054.1 E3 ligase mindbomb 1 WGK#QDGGEGHVGTVR IPI:IPI00183054.1 Uncharacterized protein (Frag ELLSAK#DAR IPI:IPI00026320.1 Optineurin QLQMDEMK#QTIAK IPI00304189 IPI00017597 Microtubule-associated proteinERDFYFSK#LR ELAV-like protein 4 DAEK#AINTLNGLR IPI00644008 ELAV-like protein 2 FANNPSQK#TNQAILSQLYQSPNRIPI00644008 Vacuolar protein sorting 36 NSYIK#LSFK IPI00328932 Elongation factor 1-alpha 1 AAGAGK#VTK IPI:IPI00396485.3 Elongation factor 1-alpha 1 FEK#EAAEMGK IPI:IPI00396485.3 Elongation factor 1-alpha 1 MDSTEPPYSQK#R IPI:IPI00396485.3 Elongation factor 1-alpha 1 QTVAVGVIK#AVDK IPI:IPI00396485.3 Elongation factor 2 VAVEAK#NPADLPK IPI:IPI00186290.6 Elongation factor 2 YFDPANGK#FSK IPI:IPI00186290.6 Uncharacterized protein (Frag AQLEEQLK#EVR IPI00292134 Uncharacterized protein DFQYIDRDGK#DQGINVR IPI:IPI00397381.5 Uncharacterized protein QLVALLK#DEER IPI:IPI00397381.5 Eukaryotic initiation factor 4A- GIYAYGFEK#PSAIQQR IPI:IPI00025491.1 Eukaryotic translation initiationEQPEK#EPELQQYVPQLQNNTILRIPI:IPI00029012.1 IPI:IPI00029012.1 Eukaryotic translation initiationQSVYEEK#LK Extended synaptotagmin-1 YVK#GLIEGK IPI00746655 Ezrin EAQDDLVK#TK IPI:IPI00843975.1 F-actin-capping protein subun IDWNK#ILSYK IPI:IPI00005969.3 Fructose-bisphosphate aldolasDNAGAATEEFIK#R IPI:IPI00418262.5 IPI:IPI00418262.5 Fructose-bisphosphate aldolasIVAPGK#GILAADESVGSMAK Fructose-bisphosphate aldolasDGADFAK#WR IPI:IPI00465439.5 IPI:IPI00465439.5 Fructose-bisphosphate aldolasGGVVGIK#VDK IPI:IPI00465439.5 Fructose-bisphosphate aldolasGILAADESTGSIAK#R Fructose-bisphosphate aldolasIVAPGK#GILAADESTGSIAK IPI:IPI00465439.5 IPI:IPI00465439.5 Fructose-bisphosphate aldolasK#DGADFAK Fructose-bisphosphate aldolasVDK#GVVPLAGTNGETTTQGLDGIPI:IPI00465439.5 IPI00796333 Fructose-bisphosphate aldolasALQASALK#AWGGK Guanine nucleotide-binding prDMTTGIVENK#FTFK IPI00328128 Ganglioside-induced differenti LAEENPDLQEAYIAK#QK IPI:IPI00290544.2 Similar to RNA-binding proteinK#FMQTFVLAPEGSVPNK IPI00009057 IPI:IPI00027497.5 Glucose-6-phosphate isomeraEWFLQAAK#DPSAVAK IPI00910781 Glucose-6-phosphate isomeraLLPHK#VFEGNRPTNSIVFTK Glutamine synthetase AYDPK#GGLDNAR IPI:IPI00010130.3 Glyceraldehyde-3-phosphate dLEK#PAKYDDIK IPI:IPI00219018.7 Glyceraldehyde-3-phosphate dTVDGPSGK#LWR IPI:IPI00219018.7 Glycogen phosphorylase, brai FQNK#TNGITPR IPI:IPI00783313.2 IPI:IPI00783097.3 Glycine-tRNA ligase (RCG525AVAELK#AR Glycine-tRNA ligase (RCG525IYLYLTK#VGISPDK IPI:IPI00783097.3 IPI:IPI00783097.3 Glycine-tRNA ligase (RCG525TSGHVDK#FADFMVK IPI:IPI00783097.3 Glycine-tRNA ligase (RCG525VLEAK#ELALQPK Golgin subfamily A member 7 VSK#YIQEQNEK IPI:IPI00480022.1 GTP-binding nuclear protein RFNVWDTAGQEK#FGGLR IPI:IPI00643041.3 GTP-binding nuclear protein RK#NLQYYDISAK IPI:IPI00643041.3 IPI:IPI00337415.9 Guanine nucleotide-binding prEVK#LLLLGAGESGK Guanine nucleotide-binding prNLREDGEK#AAR IPI:IPI00337415.9 Guanine nucleotide-binding prSTIVK#QMK IPI:IPI00337415.9 Histone H2A GK#LEAIITPPPAK IPI:IPI00059366.4 Histone H2A GVTIASGGVLPNIHPELLAK#K IPI:IPI00059366.4 Histone H2A IHPELLAK#K IPI:IPI00059366.4 IPI00304925 Hsc70, heat shock cognate 71MVQEAEK#YK Hsc70, heat shock cognate 71ALRDAK#LDK IPI00003865 Heat shock protein HSP 90-beADLINNLGTIAK#SGTK IPI:IPI00414676.6 IPI:IPI00414676.6 Heat shock protein HSP 90-beEK#YIDQEELNK Heat shock protein HSP 90-beGTK#VILHLK IPI:IPI00414676.6 Heat shock protein HSP 90-beK#HLEINPDHPIVETLR IPI:IPI00414676.6 Hebp1 protein FATVEVTDK#PVDEALR IPI:IPI00148063.1 High mobility group protein B1IK#GEHPGLSIGDVAK IPI:IPI00419258.4 Histone H1t ALAAAGYDVEK#NNSR IPI:IPI00217465.5 Histone H1t K#ALAAAGYDVEK IPI:IPI00217465.5 Histone H2A type 1 K#TESHHK IPI:IPI00081836.3 Histone H2A K#TSATVGPK IPI:IPI00219037.5 Histone H2A.Z KGQQK#TV IPI:IPI00218448.4 Histone H2B AVTK#YTSAK IPI:IPI00419833.9 Histone H2B AVTK#YTSSK IPI:IPI00018534.4 Histone H2B HAVSEGTK#AVTK IPI:IPI00018534.4 Histone H2B LLLPGELAK#HAVSEGTK IPI:IPI00018534.4 Histone H2B VLK#QVHPDTGISSK IPI:IPI00018534.4 Histone H3.3 EIAQDFK#TDLR IPI:IPI00171611.7 Proteasome 26S subunit, rpn9FYDLSSK#YYQTIGNHASYYK IPI:IPI00549672.2 Huntingtin interacting protein 1MEYHTK#NPR IPI:IPI00782965.2 Uncharacterized protein HIVENAVQK#ELR IPI00939304 Insulin receptor VAVK#TVNESASLR IPI:IPI00025803.3 Integral membrane protein 2A IAFNTPTAVQK#EEAR IPI:IPI00013888.1 Integral membrane protein 2B VTFNSALAQK#EAK IPI:IPI00031821.1 Interleukin enhancer-binding f VK#PAPDETSFSEALLK IPI:IPI00005198.2 Uncharacterized protein GTLAYLPEEYIK#TGR IPI:IPI00060149.2 Proteasome 26S subunit, ATPVVGSEFVQK#YLGEGPR IPI:IPI00020042.2 3-hydroxy-3-methylglutaryl-co VLEEEENK#PNPVTQR IPI:IPI00021770.1 Ankyrin repeat domain-containLLESLEEQEVK#GFNR IPI:IPI00329014.2 AP-2 complex subunit mu ESQISAEIELLPTNDK#K IPI:IPI00022256.3 AP-2 complex subunit mu GTADETSK#SGK IPI:IPI00022256.3 AP-2 complex subunit mu IVIEK#QGK IPI:IPI00022256.3 AP-2 complex subunit mu LSK#FDSER IPI:IPI00022256.3 Uncharacterized protein (Frag ELK#PMASGASSA IPI:IPI00221393.1 Clathrin heavy chain 1 AGK#TLQIFNIEMK IPI:IPI00024067.4 Clathrin heavy chain 1 AVNYFSK#VK IPI:IPI00024067.4 Clathrin heavy chain 1 EYLTK#VDK IPI:IPI00024067.4 Clathrin heavy chain 1 TGQIK#EVER IPI:IPI00024067.4

E3 ubiquitin-protein ligase MIB K#LFETQESGDLNEELVK E3 ubiquitin-protein ligase MIB LLLK#QNVDVEAEDKDGDR E3 ubiquitin-protein ligase MIB WGK#QDGGEGHVGTVR E3 ubiquitin-protein ligase UBRELLSAK#DAR E3-14.7K-interacting protein;FI QLQMDEMK#QTIAK EB1 protein family member 3;EERDFYFSK#LR ELAV (Embryonic lethal, abnor DAEK#AINTLNGLR ELAV (Embryonic lethal, abnor FANNPSQK#TNQAILSQLYQSPN ELL-associated protein of 45 kDNSYIK#LSFK Elongation factor 1-alpha 1 AAGAGK#VTK Elongation factor 1-alpha 1 FEK#EAAEMGK Elongation factor 1-alpha 1 MDSTEPPYSQK#R Elongation factor 1-alpha 1 QTVAVGVIK#AVDKK Elongation factor 2 VAVEAK#NPADLPK Elongation factor 2 YFDPANGK#FSK Epidermal growth factor recept AQLEEQLK#EVR epsin 2 isoform a DFQYIDRDGK#DQGINVR epsin 2 isoform a QLVALLK#DEER Eukaryotic initiation factor 4A-I GIYAYGFEK#PSAIQQR Eukaryotic translation initiation EQPEK#EPELQQYVPQLQNNTIL Eukaryotic translation initiation QSVYEEK#LK Extended synaptotagmin-1;Me DKYVK#GLIEGK Ezrin EAQDDLVK#TK F-actin-capping protein subunit IDWNK#ILSYK Fructose-bisphosphate aldolas DNAGAATEEFIK#R Fructose-bisphosphate aldolas IVAPGK#GILAADESVGSMAK Fructose-bisphosphate aldolas DGADFAK#WR Fructose-bisphosphate aldolas GGVVGIK#VDK Fructose-bisphosphate aldolas GILAADESTGSIAK#R Fructose-bisphosphate aldolas IVAPGK#GILAADESTGSIAK Fructose-bisphosphate aldolas K#DGADFAK Fructose-bisphosphate aldolas VDK#GVVPLAGTNGETTTQGLDG Fructose-bisphosphate aldolas ALQASALK#AWGGK G(x) alpha chain;Guanine nucleDMTTGIVENK#FTFK Ganglioside-induced differentiaLAEENPDLQEAYIAK#QK GAP SH3 domain-binding proteK#FMQTFVLAPEGSVPNK Glucose-6-phosphate isomerasEWFLQAAK#DPSAVAK Glucose-6-phosphate isomerasLLPHK#VFEGNRPTNSIVFTK Glutamine synthetase AYDPK#GGLDNAR Glyceraldehyde-3-phosphate d LEK#PAKYDDIK Glyceraldehyde-3-phosphate d TVDGPSGK#LWR Glycogen phosphorylase, liver DFSELEPDKFQNK#TNGITPR Glycyl-tRNA synthetase AVAELK#AR Glycyl-tRNA synthetase IYLYLTK#VGISPDK Glycyl-tRNA synthetase TSGHVDK#FADFMVK Glycyl-tRNA synthetase VLEAK#ELALQPK Golgin subfamily A member 7 VSK#YIQEQNEK GTP-binding nuclear protein RaFNVWDTAGQEK#FGGLR GTP-binding nuclear protein RaK#NLQYYDISAK Guanine nucleotide-binding proEVK#LLLLGAGESGK Guanine nucleotide-binding proNLREDGEK#AAR Guanine nucleotide-binding proSTIVK#QMK H2A histone family, member Y GK#LEAIITPPPAKK H2A histone family, member Y GVTIASGGVLPNIHPELLAK#K H2A histone family, member Y GVTIASGGVLPNIHPELLAK#K Heat shock 70 kDa protein 1/2; MVQEAEK#YK#AEDEVQR Heat shock 70 kDa protein 8;H ALRDAK#LDKSQIHDIVLVGGSTR Heat shock protein HSP 90-betADLINNLGTIAK#SGTK Heat shock protein HSP 90-betEK#YIDQEELNK Heat shock protein HSP 90-betGTK#VILHLK Heat shock protein HSP 90-betK#HLEINPDHPIVETLR Heme-binding protein 1 FATVEVTDK#PVDEALR High mobility group protein B1 IK#GEHPGLSIGDVAK Histone H1.2 ALAAAGYDVEK#NNSR Histone H1.2 K#ALAAAGYDVEK Histone H2A type 1-H VTIAQGGVLPNIQAVLLPKK#TES Histone H2A.x K#TSATVGPK Histone H2A.Z KGQQK#TV Histone H2B type 1-K AVTK#YTSAK Histone H2B type 1-L AVTK#YTSSK Histone H2B type 1-L HAVSEGTK#AVTK Histone H2B type 1-L LLLPGELAK#HAVSEGTK Histone H2B type 1-L VLK#QVHPDTGISSK Histone H3.2 EIAQDFK#TDLR HSPC027 FYDLSSK#YYQTIGNHASYYK Huntingtin-interacting protein 1 MEYHTK#NPR Importin subunit beta-3;Importi HIVENAVQK#ELR Insulin receptor precursor VAVK#TVNESASLR Integral membrane protein 2A IAFNTPTAVQK#EEAR Integral membrane protein 2B VTFNSALAQK#EAK Interleukin enhancer-binding fa VK#PAPDETSFSEALLK interleukin-1 receptor-associateGTLAYLPEEYIK#TGR Isoform 1 of 26S protease reguVVGSEFVQK#YLGEGPR Isoform 1 of 3-hydroxy-3-methyVLEEEENK#PNPVTQR Isoform 1 of Ankyrin repeat domLLESLEEQEVK#GFNR Isoform 1 of AP-2 complex sub ESQISAEIELLPTNDK#K Isoform 1 of AP-2 complex sub GTADETSK#SGK Isoform 1 of AP-2 complex sub IVIEK#QGK Isoform 1 of AP-2 complex sub LSK#FDSER Isoform 1 of Choline transporte ELK#PMASGASSA Isoform 1 of Clathrin heavy chaAGK#TLQIFNIEMK Isoform 1 of Clathrin heavy chaAVNYFSK#VK Isoform 1 of Clathrin heavy chaEYLTK#VDKLDASESLR Isoform 1 of Clathrin heavy chaTGQIK#EVER


100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P11442 P11442 G3V6T1 Q810U0 Q9EQH5 Q792H5 B5DF89 B2RYJ3 D4AD30 D4AD30 F1MA55 O88339 O88339 Q5XI32 Q68FP1 B5DEZ6 P62994 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 P63018 Q9JJ50 Q9JJ50 P17132 P61980 P05708 P05708 D4A7T9 Q6MG49 O88917 E9PTW6 D3ZY92 P55161 P55161 Q5U2S1 Q5U2S1 O35095 D3ZSQ1 P63004 P63004 Q9EPH8 P85125 P85125 P85125 D3ZUP5 Q5HZA6 D3ZA14 D3ZWA1 XP_002726316.1 P10536 XP_001070971.1 P60892 P56603 P56603 D4A0F5 B5DF55 E9PTX9 E9PTX9 Q6PEC4 Q64232 O08629 F1LYJ4 Q9JHW5 P85972 Q9R1Z0 D3ZW96 Q5XIJ5 E9PTC8 Q8CFN2 P61203 P60905 P60905 P60905 E9PTS0 D3ZBY8 P63329 D3ZER6 Q63610 P62501 P62501 Q9JJP9 P25286 P25286 P25286

Clathrin heavy chain 1 TLQIFNIEMK#SK IPI:IPI00024067.4 Clathrin heavy chain 1 VNIPK#VLR IPI:IPI00024067.4 RCG20221, isoform CRA_b QELILSNSEDK#SIR IPI:IPI00295857.7 Coiled-coil domain-containing QLQEEDLK#AQAQLQK IPI:IPI00383423.3 C-terminal-binding protein 2 GGLVDEK#ALAQALK IPI:IPI00010120.4 CUGBP Elav-like family membVFIDK#QTNLSK IPI:IPI00034015.1 Cullin 3 STEEPIVK#VVER IPI:IPI00014312.1 RGD1563853 protein DVFEAFYK#K IPI:IPI00179057.6 E3 ligase itchy EFDPLGPLPPGWEK#R IPI:IPI00061780.1 E3 ligase itchy SQGQLNEK#PLPEGWEMR IPI:IPI00061780.1 Uncharacterized protein (Frag LNDPFQPFPGNDSPK#EK IPI:IPI00292134.6 Epsin 1 DFQYVDRDGK#DQGVNVR IPI:IPI00002495.1 Epsin 1 NIVHNYSEAEIK#VR IPI:IPI00002495.1 F-actin-capping protein subun STLNEIYFGK#TK IPI:IPI00026185.6 Gelsolin TEALTSAK#R IPI:IPI00026314.1 Glucosamine-6-phosphate deaYVK#TFNMDEYVGLPR IPI:IPI00550894.4 Growth factor receptor-bound FGNDVQHFK#VLR IPI:IPI00021327.3 Hsc70, heat shock cognate 71AMTK#DNNLLGK IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71EEFEHQQK#ELEK Hsc70, heat shock cognate 71ENK#ITITNDK IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71GTLDPVEK#ALR Hsc70, heat shock cognate 71IINEPTAAAIAYGLDK#K IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71ITITNDK#GR Hsc70, heat shock cognate 71LIGDAAK#NQVAMNPTNTVFDAK IPI:IPI00003865.1 Hsc70, heat shock cognate 71LSK#EDIER IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71MVQEAEK#YKAEDEK Hsc70, heat shock cognate 71NQTAEKEEFEHQQK#ELEK IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71NQVAMNPTNTVFDAK#R IPI:IPI00003865.1 Hsc70, heat shock cognate 71QATK#DAGTIAGLNVLR Hsc70, heat shock cognate 71VQVEYK#GETK IPI:IPI00003865.1 IPI:IPI00003865.1 Hsc70, heat shock cognate 71VSSK#NSLESYAFNMK IPI:IPI00006176.3 Hepatocyte growth factor-reguFGIEK#EVR IPI:IPI00006176.3 Hepatocyte growth factor-reguYK#VVQDTYQIMK Heterogeneous nuclear ribonuIFVGGLSPDTPEEK#IR IPI:IPI00028888.1 Heterogeneous nuclear ribonuDLAGSIIGK#GGQR IPI:IPI00216049.1 Hexokinase-1 GK#FNTSDVSAIEK IPI:IPI00018246.5 Hexokinase-1 NILIDFTK#K IPI:IPI00018246.5 Uncharacterized protein DIDTQAK#YQSYFSR IPI:IPI00044725.3 Large proline-rich protein BAGEHIAASVSIPSEK#QR IPI:IPI00465128.4 Latrophilin-1 K#QTESSFMAGDINSTPTLNR IPI:IPI00183445.1 Uncharacterized protein VHK#ISNPWQSPSGTLPALR IPI:IPI00013678.2 Uncharacterized protein LNQVIFPVSYNDK#FYK IPI:IPI00018627.3 Nck-associated protein 1 LAEK#LTILNDR IPI:IPI00031982.1 Nck-associated protein 1 SVLQPSQQK#LAEK IPI:IPI00031982.1 NEDD4 family-interacting prot DESGFPK#PPSYNVATTLPSYDEAIPI:IPI00012235.3 IPI:IPI00012235.3 NEDD4 family-interacting prot TK#AEATIPLVPGR Neurochondrin NPALK#LAAR IPI:IPI00549543.1 Uncharacterized protein GSIQNAK#QALR IPI:IPI00869136.1 Platelet-activating factor acetyEEFTSGGPLGQK#R IPI:IPI00218728.4 IPI:IPI00218728.4 Platelet-activating factor acetyLNEAK#EEFTSGGPLGQK Polyadenylate-binding protein AK#EFTNVYIK IPI:IPI00008524.1 Polymerase I and transcript reAHATTSNTVSK#LLEK IPI:IPI00176903.2 IPI:IPI00176903.2 Polymerase I and transcript reLGK#AHATTSNTVSK IPI:IPI00176903.2 Polymerase I and transcript reVMIYQDEVK#LPAK RCG56448, isoform CRA_a VTK#GETLT IPI:IPI00000296.2 Prolyl endopeptidase-like LFEETGHEDPITK#TSR IPI:IPI00442171.4 Protein Efr3a LTFYAVSAPEK#LDR IPI:IPI00470711.4 Uncharacterized protein K#LQEEEDRR IPI:IPI00744140.2 PREDICTED: rCG37290-like KVEQWK#EK IPI:IPI00217537.2 Ras-related protein Rab-1B YASENVNK#LLVGNK IPI:IPI00005719.1 PREDICTED: regulator of nonNMDSMPELQK#LQQLK IPI:IPI00034049.1 Ribose-phosphate pyrophosphMVLVGDVK#DR IPI:IPI00219617.5 Secretory carrier-associated mEHALAQAELLK#R IPI:IPI00005129.8 Secretory carrier-associated mTTGASFEK#AQQEFATGVMSNK IPI:IPI00005129.8 Septin-7 IYEFPETDDEEENK#LVK IPI:IPI00033025.8 Stam1 (SH3 and VHS domain EQGVTFPAIGSQAAEQAK#ASPA IPI:IPI00020178.1 Protein Slc12a2 DAVVTYTAESK#GVVK IPI:IPI00022649.3 Protein Slc12a2 EGLDISHLQGQEELLSSQEK#SPGIPI:IPI00022649.3 S-phase kinase-associated pr TFNIK#NDFTEEEEAQVR IPI:IPI00301364.3 Trans-2,3-enoyl-CoA reductasSYLK#EFR IPI:IPI00100656.3 Transcription intermediary factVLVNDAQK#VTEGQQER IPI:IPI00438229.2 Ubiquitin specific peptidase 34TYTMDK#QPLNTGEQK IPI:IPI00297593.4 Vesicle-associated membraneTENLVDSSVTFK#TTSR IPI:IPI00020887.3 Vinculin NSK#NQGIEEALK IPI:IPI00291175.7 Voltage-dependent anion-seleDVFNK#GYGFGMVK IPI:IPI00031804.1 Uncharacterized protein QLENLEQQK#YDDEDISEDIK IPI:IPI00296191.1 Abhydrolase domain-containinVAFPDTK#K IPI:IPI00102923.3 Uncharacterized protein REPFAVVK#TASEMER IPI:IPI00106552.4 Cell division control protein 42QKPITPETAEK#LAR IPI:IPI00016786.1 COP9 signalosome complex sIDQVNQLLELDHQK#R IPI:IPI00018813.5 DnaJ homolog subfamily C meEINNAHAILTDATK#R IPI:IPI00023780.3 DnaJ homolog subfamily C meLALK#YHPDK IPI:IPI00023780.3 DnaJ homolog subfamily C meLALK#YHPDKNPDNPEAADK IPI:IPI00023780.3 Uncharacterized protein MFVGGLSWDTSK#K IPI:IPI00334587.1 Uncharacterized protein TTNEQVTGK#FR IPI:IPI00216546.3 Serine/threonine-protein phos LTAK#EVFDNDGKPR IPI:IPI00747748.1 Uncharacterized protein SLSGLILK#NNVK IPI:IPI00164417.6 Tropomyosin alpha-3 chain LEK#TIDDLEDK IPI:IPI00218319.3 TSC22 domain family protein EEVEVLK#EQIK IPI:IPI00019355.1 TSC22 domain family protein ELIEK#NSQLEQENNLLK IPI:IPI00019355.1 Ubiquilin 1 EK#EEFAVPENSSVQQFK IPI:IPI00071180.1 V-type proton ATPase 116 kD K#ANIPIMDTGENPEVPFPR IPI:IPI00743576.1 V-type proton ATPase 116 kD K#HLGTLNFGGIR IPI:IPI00743576.1 V-type proton ATPase 116 kD MQTNQTPPTYNK#TNK IPI:IPI00743576.1

Isoform 1 of Clathrin heavy chaTLQIFNIEMK#SK Isoform 1 of Clathrin heavy chaVNIPK#VLR Isoform 1 of Coatomer subunit QELILSNSEDK#SIR Isoform 1 of Coiled-coil domainQLQEEDLK#AQAQLQK Isoform 1 of C-terminal-binding GGLVDEK#ALAQALK Isoform 1 of CUG-BP- and ETRVFIDK#QTNLSK Isoform 1 of Cullin-3 STEEPIVK#VVER Isoform 1 of Cullin-4B DVFEAFYK#K Isoform 1 of E3 ubiquitin-protei EFDPLGPLPPGWEK#R Isoform 1 of E3 ubiquitin-protei SQGQLNEK#PLPEGWEMR Isoform 1 of Epidermal growth LNDPFQPFPGNDSPK#EK Isoform 1 of Epsin-1 DFQYVDRDGK#DQGVNVR Isoform 1 of Epsin-1 NIVHNYSEAEIK#VR Isoform 1 of F-actin-capping pr STLNEIYFGK#TK Isoform 1 of Gelsolin DSQEEEKTEALTSAK#R Isoform 1 of Glucosamine-6-ph YVK#TFNMDEYVGLPR Isoform 1 of Growth factor receFGNDVQHFK#VLR Isoform 1 of Heat shock cognatAMTK#DNNLLGK Isoform 1 of Heat shock cognatEEFEHQQK#ELEK Isoform 1 of Heat shock cognatENK#ITITNDK Isoform 1 of Heat shock cognatGTLDPVEK#ALR Isoform 1 of Heat shock cognatIINEPTAAAIAYGLDK#K Isoform 1 of Heat shock cognatITITNDK#GR Isoform 1 of Heat shock cognatLIGDAAK#NQVAMNPTNTVFDAK Isoform 1 of Heat shock cognatLSK#EDIER Isoform 1 of Heat shock cognatMVQEAEK#YKAEDEK#QR Isoform 1 of Heat shock cognatNQTAEKEEFEHQQK#ELEK Isoform 1 of Heat shock cognatNQVAMNPTNTVFDAK#R Isoform 1 of Heat shock cognatQATK#DAGTIAGLNVLR Isoform 1 of Heat shock cognatVQVEYK#GETK Isoform 1 of Heat shock cognatVSSK#NSLESYAFNMK Isoform 1 of Hepatocyte growthFGIEK#EVR Isoform 1 of Hepatocyte growthYK#VVQDTYQIMK Isoform 1 of Heterogeneous nuIFVGGLSPDTPEEK#IR Isoform 1 of Heterogeneous nuDLAGSIIGK#GGQR Isoform 1 of Hexokinase-1 GK#FNTSDVSAIEK Isoform 1 of Hexokinase-1 NILIDFTK#K Isoform 1 of Histone H2A deub DIDTQAK#YQSYFSR Isoform 1 of Large proline-rich EHIAASVSIPSEK#QR Isoform 1 of Latrophilin-1 K#QTESSFMAGDINSTPTLNR Isoform 1 of Metaxin-1 VHK#ISNPWQSPSGTLPALR Isoform 1 of N-acetyltransferas LNQVIFPVSYNDK#FYK Isoform 1 of Nck-associated proLAEK#LTILNDR Isoform 1 of Nck-associated proSVLQPSQQK#LAEK Isoform 1 of NEDD4 family-inteDESGFPK#PPSYNVATTLPSYDE Isoform 1 of NEDD4 family-inteTK#AEATIPLVPGR Isoform 1 of Neurochondrin NPALK#LAAR Isoform 1 of Pecanex-like proteGSIQNAK#QALR Isoform 1 of Platelet-activating LNEAKEEFTSGGPLGQK#R Isoform 1 of Platelet-activating LNEAK#EEFTSGGPLGQK Isoform 1 of Polyadenylate-bindAK#EFTNVYIK Isoform 1 of Polymerase I and AHATTSNTVSK#LLEK Isoform 1 of Polymerase I and LGK#AHATTSNTVSK Isoform 1 of Polymerase I and VMIYQDEVK#LPAK Isoform 1 of Probable protein BVTK#GETLT Isoform 1 of Prolyl endopeptidaLFEETGHEDPITK#TSR Isoform 1 of Protein EFR3 homLTFYAVSAPEK#LDR Isoform 1 of Protein FAM63B K#LQEEEDRR Isoform 1 of Putative PolycombKVEQWK#EK Isoform 1 of Ras-related proteinYASENVNK#LLVGNK Isoform 1 of Regulator of nonseNMDSMPELQK#LQQLK Isoform 1 of Ribose-phosphate MVLVGDVK#DR Isoform 1 of Secretory carrier-aEHALAQAELLK#R Isoform 1 of Secretory carrier-aTTGASFEK#AQQEFATGVMSNK Isoform 1 of Septin-7 IYEFPETDDEEENK#LVK Isoform 1 of Signal transducingEQGVTFPAIGSQAAEQAK#ASPA Isoform 1 of Solute carrier fami DAVVTYTAESK#GVVK Isoform 1 of Solute carrier fami EGLDISHLQGQEELLSSQEK#SP Isoform 1 of S-phase kinase-asTFNIK#NDFTEEEEAQVR Isoform 1 of Synaptic glycoprot SYLK#EFR Isoform 1 of Transcription inter VLVNDAQK#VTEGQQER Isoform 1 of Ubiquitin carboxyl-TYTMDK#QPLNTGEQK Isoform 1 of Vesicle-associatedTENLVDSSVTFK#TTSR Isoform 1 of Vinculin NSK#NQGIEEALK Isoform 1 of Voltage-dependen DVFNK#GYGFGMVK Isoform 1 of V-type proton ATPQLENLEQQK#YDDEDISEDIK Isoform 2 of Abhydrolase domaVAFPDTK#K Isoform 2 of Activating molecul REPFAVVK#TASEMER Isoform 2 of Cell division controQKPITPETAEK#LAR Isoform 2 of COP9 signalosom IDQVNQLLELDHQK#R Isoform 2 of DnaJ homolog subEINNAHAILTDATK#R Isoform 2 of DnaJ homolog subLALK#YHPDKNPDNPEAADK Isoform 2 of DnaJ homolog subLALK#YHPDKNPDNPEAADK Isoform 2 of Heterogeneous nuMFVGGLSWDTSK#K Isoform 2 of Probable palmitoy TTNEQVTGK#FR Isoform 2 of Serine/threonine-pLTAK#EVFDNDGKPR Isoform 2 of Transportin-2 SLSGLILK#NNVK Isoform 2 of Tropomyosin alphaLEK#TIDDLEDK Isoform 2 of TSC22 domain famEEVEVLK#EQIK Isoform 2 of TSC22 domain famELIEK#NSQLEQENNLLK Isoform 2 of Ubiquilin-1 EK#EEFAVPENSSVQQFK Isoform 2 of V-type proton ATPK#ANIPIMDTGENPEVPFPR Isoform 2 of V-type proton ATPK#HLGTLNFGGIR Isoform 2 of V-type proton ATPMQTNQTPPTYNK#TNK


Page 52 of 60

100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100

Page 53 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q5RKI0 Q9ERE6 Q62915 D3ZSM8 D3ZTZ8 D3ZTZ8 F1M1L4 Q2TL32 Q9JIL3 P48679 D3Z8K9 Q6RUV5 Q6RUV5 Q6RUV5 P41350 P49186 P04764 P04764 P04764 P08592 XP_001073579.1 P53563 P13233 P40329 P11505 P11505 P11505 P11506 P11505 P11506 P11506 P11506 P11505 P11506 P63095 D4A0U9 P35213 P35213 P35213 P35213 P35213 Q924K2 F1M787 P06687 P06685 P06687 P06687 P06685 P06687 P06687 P06687 P06687 P06687 D3ZVQ0 D3ZVQ0 D3ZVQ0 D3ZVQ0 D3ZVQ0 D3ZVQ0 P11980 P11980 Q64119 P97829-2 D4A9C9 P18420 D4ACD3 Q64542-2 Q64542-2 Q64542-2 P31000 G3V6L4 B0BNK1 P70615 P70615 P13668 Q9Z250 P97544 F1LX73 D3ZJ01 P42123 P42123 O88989 P43244 D4ABB2 Q6AYF7 P62078 Q9WVJ4 O35763 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8 Q71UE8


WD repeat-containing protein DYSGQGVVK#LDVQPK IPI:IPI00216256.3 Myosin phosphatase Rho-inte GWLTK#QYEDGQWK IPI:IPI00166518.6 Peripheral plasma membrane LENSK#NGTAGLIPSPELQEWR IPI:IPI00335131.4 Uncharacterized protein IISPK#NNPPTIVQDK IPI:IPI00328178.3 Uncharacterized protein K#TVTYEDPQAVGGLASALDNR IPI:IPI00328178.3 Uncharacterized protein TDLK#GDDLEEGVTSEEFDK IPI:IPI00328178.3 Uncharacterized protein (Frag LYQQIK#AGAYDFPSPEWDTVTP IPI:IPI00172450.2 E3 ubiquitin-protein ligase UB MAAETDPHK#SSEITK IPI:IPI00180305.7 IPI:IPI00219330.2 Interleukin enhancer-binding f VGLVAK#GLLLK Prelamin-A/C EELDFQK#NIYSEELR IPI:IPI00021405.3 Similar to RNA-binding proteinQYYTLLNK#APEYLHR IPI:IPI00009057.2 Ras-related C3 botulinum toxi GLK#TVFDEAIR IPI:IPI00010271.3 Ras-related C3 botulinum toxi K#LTPITYPQGLAMAK IPI:IPI00010271.3 Ras-related C3 botulinum toxi LDLRDDK#DTIEK IPI:IPI00010271.3 Caveolin-1 EQGNIYK#PNNK IPI:IPI00009236.5 Mitogen-activated protein kinaVIEQLGTPSAEFMK#K IPI:IPI00024673.2 Alpha-enolase GVSK#AVEHINK IPI:IPI00465248.5 Alpha-enolase IEEELGSK#AK IPI:IPI00465248.5 Alpha-enolase YGK#DATNVGDEGGFAPNILENK IPI:IPI00465248.5 APP, amyloid precursor protei HLSK#MQQNGYENPTYK IPI:IPI00006608.1 IPI:IPI00098523.1 PREDICTED: DnaJ (Hsp40) hQVAEAYEVLSDAK#K Bcl-2-like protein 1 EVIPMAAVK#QALR IPI:IPI00019983.1 2',3'-cyclic-nucleotide 3'-phospAGQVFLEELGNHK#AFK IPI:IPI00220993.1 Arginyl-tRNA synthetase, cyto SDGGYTYDTSDLAAIK#QR IPI:IPI00004860.2 Plasma membrane calcium-traAK#AQDGAAMEMQPLK IPI:IPI00021695.1 Plasma membrane calcium-traAQDGAAMEMQPLK#SEEGGDGDIPI:IPI00021695.1 Plasma membrane calcium-traDRDDIVK#TVIEPMASEGLR IPI:IPI00021695.1 IPI:IPI00021695.1 Plasma membrane calcium-traIRNEK#GEIEQER IPI:IPI00021695.1 Plasma membrane calcium-traLK#TSPNEGLSGNPADLER Plasma membrane calcium-traNEK#GEIEQER IPI:IPI00021695.1 IPI:IPI00021695.1 Plasma membrane calcium-traNK#PLISR IPI:IPI00021695.1 Plasma membrane calcium-traQVVAVTGDGTNDGPALK#K Plasma membrane calcium-traSLDK#DPLLLSGTHVMEGSGR IPI:IPI00021695.1 Plasma membrane calcium-traSSLYEGLEK#PESR IPI:IPI00021695.1 Guanine nucleotide-binding prIDVIK#QADYVPSDQDLLR IPI:IPI00219835.1 RCG61559 AIMYEETTYSK#K IPI:IPI00384456.4 14-3-3 protein beta/alpha QTTVSNSQQAYQEAFEISK#K IPI:IPI00216318.5 14-3-3 protein beta/alpha SELVQK#AK IPI:IPI00216318.5 14-3-3 protein beta/alpha VISSIEQK#TER IPI:IPI00216318.5 14-3-3 protein beta/alpha YLSEVASGDNK#QTTVSNSQQAYIPI:IPI00216318.5 14-3-3 protein beta/alpha YLSEVASGDNK#QTTVSNSQQAYIPI:IPI00216318.5 FAS-associated factor 1 TGDVEDSTVLK#SLHLPK IPI:IPI00070643.6 Uncharacterized protein SPSIDSIQK#DPR IPI:IPI00021076.1 Sodium/potassium-transportin AIAK#GVGIISEGNETVEDIAAR IPI:IPI00006482.1 IPI:IPI00006482.1 Sodium/potassium-transportin AVFQANQENLPILK#R IPI:IPI00006482.1 Sodium/potassium-transportin IMESFK#NMVPQQALVIR Sodium/potassium-transportin K#ADIGVAMGIAGSDVSK IPI:IPI00006482.1 IPI:IPI00006482.1 Sodium/potassium-transportin K#EVSMDDHK Sodium/potassium-transportin LIFDNLK#K IPI:IPI00006482.1 IPI:IPI00006482.1 Sodium/potassium-transportin QGAIVAVTGDGVNDSPALK#K Sodium/potassium-transportin SSK#IMESFK IPI:IPI00006482.1 Sodium/potassium-transportin TDK#LVNER IPI:IPI00006482.1 IPI:IPI00006482.1 Sodium/potassium-transportin VIMVTGDHPITAK#AIAK Ubiquitin specific peptidase 5 ALIGK#GHPEFSTNR IPI:IPI00024664.1 Ubiquitin specific peptidase 5 HFNK#TGQR IPI:IPI00024664.1 Ubiquitin specific peptidase 5 LEK#IFQNAPTDPTQDFSTQVAK IPI:IPI00024664.1 Ubiquitin specific peptidase 5 SAADSISESVPVGPK#VR IPI:IPI00024664.1 Ubiquitin specific peptidase 5 SVAVK#TTR IPI:IPI00024664.1 Ubiquitin specific peptidase 5 VPK#AGDR IPI:IPI00024664.1 Pyruvate kinase isozymes M1 K#GVNLPGAAVDLPAVSEK IPI:IPI00479186.7 Pyruvate kinase isozymes M1 NIK#IISK IPI:IPI00479186.7 Myosin light polypeptide 6 NK#DQGTYEDYVEGLR IPI:IPI00335168.9 Isoform 2 of Leukocyte surfaceAVEEPLNAFK#ESK IPI:IPI00374740.3 Uncharacterized protein ILSK#LHTVQPK IPI:IPI00022694.3 Proteasome 26S subunit, alphLVSLIGSK#TQIPTQR IPI:IPI00016832.1 IPI:IPI00219886.1 Ubiquitin specific peptidase 25LVLNYK#PPSNAQDLPR Isoform XA of Plasma membraLK#TSPVEGLSGNPADLEK IPI:IPI00217169.1 Isoform XA of Plasma membraNEK#GEVEQEK IPI:IPI00217169.1 Isoform XA of Plasma membraTSPVEGLSGNPADLEK#R IPI:IPI00217169.1 Vimentin K#LLEGEESR IPI:IPI00554648.3 Kinesin family member 5C (Pr TGAEGAVLDEAK#NINK IPI:IPI00012837.1 RCG32615, isoform CRA_a NWVK#ELQR IPI00016339 Lamin-B1 K#QLADETLLK IPI:IPI00217975.4 Lamin-B1 K#SLEGDLEDLK IPI:IPI00217975.4 Stathmin REHEK#EVLQK IPI00479997 Protein lin-7 homolog A ATAK#ATVAAFAASEGHSHPR IPI:IPI00019997.1 Lipid phosphate phosphohydroAIVPESK#NGGSPALNNNPR IPI:IPI00021453.1 Uncharacterized protein (Frag DLSK#PIGALNPK IPI:IPI00002255.4 Similar to RIKEN cDNA 23100IFTNTK#VKPQFQEILR IPI00023330 L-lactate dehydrogenase B ch GLTSVINQK#LK IPI:IPI00219217.3 L-lactate dehydrogenase B ch SADTLWDIQK#DLK IPI:IPI00219217.3 Malate dehydrogenase, cytoplLQGK#EVGVYEALK IPI:IPI00291005.8 Matrin-3 FLNK#LAEER IPI:IPI00017297.1 Megalencephalic leukoencephSPLK#EFDK IPI00014240 Microfibril-associated glycoproLQK#AFEIAK IPI00479746 Mitochondrial import inner me FAQIVQK#GGQ IPI:IPI00001546.1 Synaptojanin-2-binding proteinLQEGDK#ILSVNGQDLK IPI00299193 Moesin VLEQHK#LNK IPI:IPI00219365.3 Nedd8 EIEIDIEPTDK#VER IPI:IPI00020008.1 Nedd8 IK#ERVEEK IPI:IPI00020008.1 Nedd8 LIYSGK#QMNDEK IPI:IPI00020008.1 Nedd8 QMNDEK#TAADYK IPI:IPI00020008.1 Nedd8 TLTGK#EIEIDIEPTDK IPI:IPI00020008.1 Nedd8 TLTGK#EIEIDIEPTDKVER IPI:IPI00020008.1

Isoform 2 of WD repeat-containDYSGQGVVK#LDVQPK Isoform 3 of Myosin phosphata GWLTK#QYEDGQWK Isoform 3 of Peripheral plasma LENSK#NGTAGLIPSPELQEWR Isoform 3 of TOM1-like protein IISPK#NNPPTIVQDK Isoform 3 of TOM1-like protein K#TVTYEDPQAVGGLASALDNR Isoform 3 of TOM1-like protein TDLK#GDDLEEGVTSEEFDK Isoform 4 of Calcium/calmoduli LYQQIK#AGAYDFPSPEWDTVTP Isoform 5 of E3 ubiquitin-protei MAAETDPHK#SSEITK Isoform 5 of Interleukin enhanc VGLVAK#GLLLK Isoform A of Lamin-A/C EELDFQK#NIYSEELR Isoform A of Ras GTPase-activQYYTLLNK#APEYLHR Isoform A of Ras-related C3 boGLK#TVFDEAIR Isoform A of Ras-related C3 boK#LTPITYPQGLAMAK Isoform A of Ras-related C3 boLDLRDDK#DTIEK Isoform Alpha of Caveolin-1 EQGNIYK#PNNK Isoform Alpha-2 of Mitogen-act VIEQLGTPSAEFMK#K Isoform alpha-enolase of AlphaGVSK#AVEHINK Isoform alpha-enolase of AlphaIEEELGSK#AK Isoform alpha-enolase of AlphaYGK#DATNVGDEGGFAPNILENK Isoform APP770 of Amyloid be HLSK#MQQNGYENPTYK Isoform B of DnaJ homolog subQVAEAYEVLSDAK#K Isoform Bcl-X(L) of Bcl-2-like p EVIPMAAVK#QALR Isoform CNPI of 2',3'-cyclic-nucAGQVFLEELGNHK#AFK Isoform Complexed of Arginyl-t SDGGYTYDTSDLAAIK#QR Isoform D of Plasma membraneAK#AQDGAAMEMQPLK Isoform D of Plasma membraneAQDGAAMEMQPLK#SEEGGDGD Isoform D of Plasma membraneDRDDIVK#TVIEPMASEGLR Isoform D of Plasma membraneIRNEK#GEIEQER Isoform D of Plasma membraneLK#TSPNEGLSGNPADLER Isoform D of Plasma membraneNEK#GEIEQER Isoform D of Plasma membraneNK#PLISR Isoform D of Plasma membraneQVVAVTGDGTNDGPALK#K Isoform D of Plasma membraneSLDK#DPLLLSGTHVMEGSGR Isoform D of Plasma membraneSSLYEGLEK#PESR Isoform Gnas-2 of Guanine nucIDVIK#QADYVPSDQDLLR Isoform GTBP-N of DNA mismaAIMYEETTYSK#K Isoform Long of 14-3-3 protein QTTVSNSQQAYQEAFEISK#K Isoform Long of 14-3-3 protein SELVQK#AK Isoform Long of 14-3-3 protein VISSIEQK#TER Isoform Long of 14-3-3 protein YLSEVASGDNK#QTTVSNSQQAY Isoform Long of 14-3-3 protein YLSEVASGDNK#QTTVSNSQQAY Isoform Long of FAS-associate TGDVEDSTVLK#SLHLPK Isoform Long of Plakophilin-4 SPSIDSIQK#DPR Isoform Long of Sodium/potassAIAK#GVGIISEGNETVEDIAAR Isoform Long of Sodium/potassAVFQANQENLPILK#R Isoform Long of Sodium/potassIMESFK#NMVPQQALVIR Isoform Long of Sodium/potassK#ADIGVAMGIAGSDVSK Isoform Long of Sodium/potassDMDELKK#EVSMDDHK Isoform Long of Sodium/potassLIFDNLK#K Isoform Long of Sodium/potassQGAIVAVTGDGVNDSPALK#K Isoform Long of Sodium/potassSSK#IMESFK Isoform Long of Sodium/potassTDK#LVNER Isoform Long of Sodium/potassVIMVTGDHPITAK#AIAK Isoform Long of Ubiquitin carboALIGK#GHPEFSTNR Isoform Long of Ubiquitin carboHFNK#TGQR Isoform Long of Ubiquitin carboLEK#IFQNAPTDPTQDFSTQVAK Isoform Long of Ubiquitin carboSAADSISESVPVGPK#VR Isoform Long of Ubiquitin carboSVAVK#TTR Isoform Long of Ubiquitin carboVPK#AGDR Isoform M2 of Pyruvate kinase K#GVNLPGAAVDLPAVSEK Isoform M2 of Pyruvate kinase NIK#IISK Isoform Non-muscle of Myosin NK#DQGTYEDYVEGLR Isoform OA3-323 of Leukocyte KAVEEPLNAFK#ESK Isoform Rpn10A of 26S proteasILSK#LHTVQPK Isoform Short of Proteasome s LVSLIGSK#TQIPTQR Isoform Short of Ubiquitin carboLVLNYK#PPSNAQDLPR Isoform XB of Plasma membra LK#TSPVEGLSGNPADLEK Isoform XB of Plasma membra NEK#GEVEQEKLDK Isoform XB of Plasma membra TSPVEGLSGNPADLEK#R Keratin, type II cytoskeletal 8 K#LLEGEESR Kinesin-1 heavy chain TGAEGAVLDEAK#NINK L1880;RAB5L;Ras-related prot NWVK#ELQR Lamin-B1 K#QLADETLLK Lamin-B1 K#SLEGDLEDLK Leukemia-associated phospho REHEK#EVLQK Lin-7 homolog C ANATAK#ATVAAFAASEGHSHPR Lipid phosphate phosphohydro AIVPESK#NGGSPALNNNPR Lipopolysaccharide-responsive DLSK#PIGALNPK LisH domain and HEAT repeat-IFTNTK#VKPQFQEILR L-lactate dehydrogenase B chaGLTSVINQK#LKDDEVAQLK L-lactate dehydrogenase B chaSADTLWDIQK#DLK Malate dehydrogenase, cytoplaLQGK#EVGVYEALK Matrin-3 FLNK#LAEER Membrane protein MLC1;cDNASPLK#EFDK Microfibrillar-associated proteinLQK#AFEIAK Mitochondrial import inner memFAQIVQK#GGQ Mitochondrial outer membrane LQEGDK#ILSVNGQDLK Moesin VLEQHK#LNK NEDD8 EIEIDIEPTDK#VER NEDD8 IK#ERVEEK NEDD8 LIYSGK#QMNDEK NEDD8 QMNDEK#TAADYK NEDD8 TLTGK#EIEIDIEPTDK NEDD8 TLTGK#EIEIDIEPTDKVER


100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

D3ZL58 Q99MI7 Q5PQN0 Q9WU34 P62749 P61972 P19804 P19804 P19804 P19804 Q9Z2G8 P56558 P31662 D3ZZP8 P10111 Q63716 P16446 D3ZSI4 P16617 P16617 P25113 P25113 P25113 P60892 P11506 P11506 P11505 P11505 D3ZCS3 A0JPI6 D3ZUP5 P83868 Q9JMB5 P17220 P60901 P60901 P60901 G3V7Q6 F1LTW9 B2GUZ9 B2GUZ9 B2GUZ9 D3ZTB5 XP_001075834.1 A7VJC2 D3ZTM3 D3ZZY4 P50398 E9PT65 E9PT65 P61107 P61107 D4AD40 Q5XI73 Q32PX6 Q32PX6 D3ZTD8 Q9QZR6 Q64303 Q5XI34 Q5XI34 Q5XI34 Q5XI34 Q5XI34 Q5XI34 P62716 P62716 P62138 D4A511 D3ZDK2 G3V7F6 O70593 Q80W98 Q9JJP0 Q63488 Q63488 P11167 Q794F9 Q5U211 E9PU13 P13668 P13668 D3ZUM2 Q62876 P21707 P34901 P28480 D4AC23 D4AD79 F1LRY3 Q6P5P3 Q5M7W1 Q920J4 Q920J4

Uncharacterized protein QLFK#ELYIDPSK IPI:IPI00157365.2 NEDD8-activating enzyme E1 LTQGVVK#R IPI:IPI00328154.4 Neurocalcin-delta K#IYGNFFPYGDASK IPI00555920 Neuronal-specific septin-3 K#ELEVNGIEFYPQK IPI00384187 Hippocalcin-like protein 1 MVSSVMK#MPEDESTPEK IPI:IPI00219103.6 Nuclear transport factor 2 AAIVEK#LSSLPFQK IPI:IPI00009901.1 Nucleoside diphosphate kinas QHYIDLK#DRPFFPGLVK IPI:IPI00604590.3 IPI:IPI00604590.3 Nucleoside diphosphate kinas TFIAIK#PDGVQR Nucleoside diphosphate kinas VMLGETNPADSK#PGTIR IPI:IPI00604590.3 Nucleoside diphosphate kinas ASEEHLK#QHYIDLK IPI00604590 Nucleosome assembly proteinK#YAVLYQPLFDK IPI:IPI00023860.1 IPI00005780 UDP-N-acetylglucosamine--peISSPLFNTK#QYTMELER IPI:IPI00335355.3 Sodium-dependent neutral amFILSK#VPSEAPSPMPTHR Uncharacterized protein ILK#AHGEK IPI:IPI00293200.3 Peptidyl-prolyl cis-trans isome SIYGEK#FEDENFILK IPI:IPI00419585.9 Peroxiredoxin-1 DISLSDYK#GK IPI:IPI00000874.1 IPI00216048 Phosphatidylinositol transfer pSQVLSK#DYK Uncharacterized protein GAIQLGITHTVGSLSTK#PER IPI:IPI00922583.1 Phosphoglycerate kinase 1 VDFNVPMK#NNQITNNQR IPI:IPI00169383.3 Phosphoglycerate kinase 1 VK#AEPAK IPI:IPI00169383.3 Phosphoglycerate mutase 1 AETAAK#HGEAQVK IPI:IPI00549725.6 Phosphoglycerate mutase 1 HGEAQVK#IWR IPI:IPI00549725.6 Phosphoglycerate mutase 1 HYGGLTGLNK#AETAAK IPI:IPI00549725.6 IPI00219616 Ribose-phosphate pyrophosphIFSGSSHQDLSQK#IADR Plasma membrane calcium-traGEIEQERIDK#IWPK IPI00021695 IPI00021695 Plasma membrane calcium-traIDK#IWPK Plasma membrane calcium-traIEQEQK#FTVIR IPI00021695 IPI00021695 Plasma membrane calcium-traILPPEK#EGGLPR Uncharacterized protein EVGSIIGK#K IPI:IPI00016610.2 Uncharacterized protein ERYEK#EFSQER IPI00398974 RCG56448, isoform CRA_a EYIEIITSSIK#K IPI00844425 Prostaglandin E synthase 3 DVNVNFEK#SK IPI:IPI00015029.1 IPI:IPI00033030.2 Proteasome 26S subunit, rpn1MSLK#GTTVTPDK Proteasome 26S subunit, alphVEPITK#HIGLVYSGMGPDYR IPI:IPI00219622.3 Proteasome 26S subunit, alphARYEAANWK#YK IPI:IPI00029623.1 Proteasome 26S subunit, alphATAAGVK#QTESTSFLEK IPI:IPI00029623.1 IPI:IPI00029623.1 Proteasome 26S subunit, alphYEAANWK#YK IPI:IPI00479306.1 Proteasome 26S subunit, betaATAGAYIASQTVK#K Uncharacterized protein (Frag TNMEK#LTFYALSAPEK IPI00896386 Fam49b protein EAIQHPADEK#LQEK IPI:IPI00303318.2 Fam49b protein FDELK#MTNPAIQNDFSYYR IPI:IPI00303318.2 Fam49b protein LQEK#AWGAVVPLVGK IPI:IPI00303318.2 Uncharacterized protein MK#SLDVNQDSELK IPI:IPI00016179.1 PREDICTED: hect (homologo TMVQGK#NYGPQITVK IPI00022479 IPI:IPI00386854.6 Heterogeneous nuclear ribonuEESGKPGAHVTVK#K Uncharacterized protein AGK#YLEHGEYEGNLYGTK IPI00917964 RCG54790, isoform CRA_c IEGLAPK#LDPEEMK IPI00908537 Rab GDP dissociation inhibito NPYYGGESSSITPLEELYK#R IPI:IPI00010154.3 Uncharacterized protein K#QLQALSSELAQAR IPI:IPI00017367.6 Uncharacterized protein VLEQHK#LTK IPI:IPI00017367.6 Ras-related protein Rab-14 IYQNIQDGSLDLNAAESGVQHK#PIPI:IPI00291928.8 Ras-related protein Rab-14 TGENVEDAFLEAAK#K IPI:IPI00291928.8 Regulator of chromosome conEFIAK#ASK IPI:IPI00329626.3 IPI:IPI00003815.3 Rho GDP-dissociation inhibito IDK#TDYMVGSYGPR Ras homolog gene family, me LK#EQGQAPITPQQGQALAK IPI:IPI00017342.1 Ras homolog gene family, me EQGQAPITPQQGQALAK#QIHAVRIPI00017342 RCG53309 YDSVEAIK#AFNK IPI00013880 Septin-9 SITHDIEEK#GVR IPI:IPI00784614.1 Serine/threonine-protein kinasDIK#SDNVLLGMEGSVK IPI:IPI00419979.3 Protein phosphatase 2 (FormeAAASHK#VK IPI:IPI00554737.3 Protein phosphatase 2 (FormeAAASK#LGEFAK IPI:IPI00554737.3 Protein phosphatase 2 (FormeFTELQK#AVGPEITK IPI:IPI00554737.3 Protein phosphatase 2 (FormeRAAASK#LGEFAK IPI:IPI00554737.3 Protein phosphatase 2 (FormeVSSAVK#AELR IPI:IPI00554737.3 Protein phosphatase 2 (FormeYMVADK#FTELQK IPI:IPI00554737.3 Serine/threonine-protein phos EILTK#ESNVQEVR IPI:IPI00008380.1 Serine/threonine-protein phos IGGK#SPDTNYLFMGDYVDR IPI:IPI00008380.1 Serine/threonine-protein phos LLEVQGSRPGK#NVQLTENEIR IPI:IPI00550451.1 Signal recognition particle 9 kDAAEK#LYLADPMK IPI:IPI00216125.6 Ubiquitin-conjugating enzyme EWTQK#YAM IPI:IPI00024013.1 RCG23529, isoform CRA_a ELTSLVK#EVYPEAR IPI:IPI00011698.4 Small glutamine-rich tetratrico SNLK#IAELK IPI:IPI00013949.1 Small glutamine-rich tetratrico SNLK#IAEQK IPI:IPI00061623.1 Sodium-dependent phosphateDSGLYK#ELLHK IPI:IPI00023035.2 Sodium-dependent phosphateK#VQEAESPVFK IPI:IPI00009504.2 Sodium-dependent phosphateVQEAESPVFK#ELPGAK IPI:IPI00009504.2 Solute carrier family 2, facilitatQGGASQSDK#TPEELFHPLGADSIPI:IPI00220194.6 4F2 cell-surface antigen heavyFTGLSK#EELLK IPI:IPI00554702.1 Sorting nexin-3 VVVPPLPGK#AFLR IPI00815770 Uncharacterized protein VLEEQINEGEQQLK#SK IPI:IPI00029403.1 Stathmin DLSLEEIQK#K IPI:IPI00479997.4 Stathmin EAQMAAK#LER IPI:IPI00479997.4 Sterile alpha and TIR motif co TK#VFSDIGAIQSLK IPI00448630 Synaptogyrin-1 M]EGGAYGAGK#AGGAFDPYTLVIPI00013940 Synaptotagmin-1 DQALK#DDDAETGLTDGEEKEEPIPI:IPI00009439.1 Syndecan-4 K#APTNEFYA IPI:IPI00011564.1 T-complex protein 1 subunit a LHPESK#DDK IPI:IPI00290566.1 RCG55994, isoform CRA_c GK#ATISNDGATILK IPI:IPI00018465.1 Uncharacterized protein HK#SETDTSLIR IPI:IPI00027626.3 Uncharacterized protein (Frag YSLAEK#ILR IPI00456534 Tetratricopeptide repeat prote RLQEAQLYK#EEGNQR IPI:IPI00175096.1 IPI:IPI00007956.4 Thioredoxin-interacting proteinVYGSGEK#VAGR Thioredoxin-like protein 1 IDQYQGADAVGLEEK#IK IPI:IPI00305692.5 Thioredoxin-like protein 1 LYSMK#FQGPDNGQGPK IPI:IPI00305692.5

NEDD8 ultimate buster 1 (NegaQLFK#ELYIDPSK NEDD8-activating enzyme E1 cLTQGVVK#R Neurocalcin delta variant;NeuroK#IYGNFFPYGDASK Neuronal-specific septin-3;Neu K#ELEVNGIEFYPQK Neuron-specific calcium-bindin MVSSVMK#MPEDESTPEK Nuclear transport factor 2 AAIVEK#LSSLPFQK Nucleoside diphosphate kinaseQHYIDLK#DRPFFPGLVK Nucleoside diphosphate kinaseTFIAIK#PDGVQR Nucleoside diphosphate kinaseVMLGETNPADSK#PGTIR Nucleoside diphosphate kinaseASEEHLK#QHYIDLK Nucleosome assembly protein K#YAVLYQPLFDK O-GlcNAc transferase subunit ISSPLFNTK#QYTMELER Orphan sodium- and chloride-dFILSK#VPSEAPSPMPTHR P53-associated parkin-like cytoILK#AHGEK Peptidyl-prolyl cis-trans isomer SIYGEK#FEDENFILK Peroxiredoxin-1 DISLSDYK#GK Phosphatidylinositol transfer pr SQVLSK#DYK phosphatidylinositol-4-phosphaGAIQLGITHTVGSLSTK#PER Phosphoglycerate kinase 1 VDFNVPMK#NNQITNNQR Phosphoglycerate kinase 1 VK#AEPAKIEAFR Phosphoglycerate mutase 1 AETAAK#HGEAQVK Phosphoglycerate mutase 1 HGEAQVK#IWR Phosphoglycerate mutase 1 HYGGLTGLNK#AETAAK Phosphoribosyl pyrophosphate IFSGSSHQDLSQK#IADR Plasma membrane calcium AT GEIEQERIDK#IWPK Plasma membrane calcium AT GEIEQERIDK#IWPK Plasma membrane calcium AT IEQEQK#FTVIR Plasma membrane calcium AT ILPPEK#EGGLPR Poly(rC)-binding protein 1 EVGSIIGK#K Probable palmitoyltransferase ZERYEK#EFSQER Probable protein BRICK1;Prob EYIEIITSSIK#K Prostaglandin E synthase 3 DVNVNFEK#SK Proteasomal ubiquitin receptor MSLK#GTTVTPDK Proteasome subunit alpha typeVEPITK#HIGLVYSGMGPDYR Proteasome subunit alpha typeARYEAANWK#YK Proteasome subunit alpha typeATAAGVK#QTESTSFLEK Proteasome subunit alpha typeYEAANWK#YK Proteasome subunit beta type- ATAGAYIASQTVK#K Protein EFR3 homolog B;cDNATNMEK#LTFYALSAPEK Protein FAM49B EAIQHPADEK#LQEK Protein FAM49B FDELK#MTNPAIQNDFSYYR Protein FAM49B LQEK#AWGAVVPLVGK Protein S100-A13 MK#SLDVNQDSELK Putative uncharacterized prote TMVQGK#NYGPQITVK Putative uncharacterized prote EESGKPGAHVTVK#K Putative uncharacterized prote AGK#YLEHGEYEGNLYGTK Putative uncharacterized prote IEGLAPK#LDPEEMKR Rab GDP dissociation inhibitor NPYYGGESSSITPLEELYK#R Radixin, isoform CRA_a K#QLQALSSELAQAR Radixin, isoform CRA_a VLEQHK#LTK Ras-related protein Rab-14 IYQNIQDGSLDLNAAESGVQHK# Ras-related protein Rab-14 TGENVEDAFLEAAK#K RCC1 and BTB domain-containEFIAK#ASK Rho GDP-dissociation inhibitor IDK#TDYMVGSYGPR Rho-related GTP-binding prote LK#EQGQAPITPQQGQALAK Rho-related GTP-binding prote EQGQAPITPQQGQALAK#QIHAV Semaphorin-5A;Semaphorin-F YDSVEAIK#AFNK septin 9 isoform a SITHDIEEK#GVR Serine/threonine-protein kinaseDIK#SDNVLLGMEGSVK Serine/threonine-protein phosp AAASHK#VK Serine/threonine-protein phosp AAASK#LGEFAK Serine/threonine-protein phosp FTELQK#AVGPEITK Serine/threonine-protein phosp RAAASK#LGEFAK Serine/threonine-protein phosp VSSAVK#AELR Serine/threonine-protein phosp YMVADK#FTELQK Serine/threonine-protein phosp EILTK#ESNVQEVR Serine/threonine-protein phosp IGGK#SPDTNYLFMGDYVDR Serine/threonine-protein phosp LLEVQGSRPGK#NVQLTENEIR signal recognition particle 9kDaAAEK#LYLADPMK similar to Putative ubiquitin-conEWTQK#YAM Sin3A-associated protein, 18kDELTSLVK#EVYPEAR Small glutamine-rich tetratricopSNLK#IAELK Small glutamine-rich tetratricopSNLK#IAEQK Sodium-dependent phosphate DSGLYK#ELLHK Sodium-dependent phosphate VSDESLSK#VQEAESPVFK Sodium-dependent phosphate VQEAESPVFK#ELPGAK Solute carrier family 2, facilitateQGGASQSDK#TPEELFHPLGAD solute carrier family 3, member FTGLSK#EELLK Sorting nexin-12;Putative unch VVVPPLPGK#AFLR Sorting nexin-4 VLEEQINEGEQQLK#SK Stathmin DLSLEEIQK#K Stathmin EAQMAAK#LER Sterile alpha and Armadillo rep TK#VFSDIGAIQSLK Synaptogyrin-1;Synaptogyrin-1 M]EGGAYGAGK#AGGAFDPYTLV Synaptotagmin-1 DQALK#DDDAETGLTDGEEKEEP Syndecan-4 K#APTNEFYA T-complex protein 1 subunit alpLHPESK#DDK T-complex protein 1 subunit etaGK#ATISNDGATILK T-complex protein 1 subunit ze HK#SETDTSLIR Tetratricopeptide repeat proteinYSLAEK#ILR Tetratricopeptide repeat proteinRLQEAQLYK#EEGNQR Thioredoxin-interacting protein SFEVVFNDPEKVYGSGEK#VAGR Thioredoxin-like protein 1 IDQYQGADAVGLEEK#IK Thioredoxin-like protein 1 LYSMK#FQGPDNGQGPK


Page 54 of 60

100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100

Page 55 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q5U1Z2 B0BNE3 Q9EQS0 P46462 P46462 P46462 P46462 P46462 P46462 Q53AQ4 P48500 P48500 P48500 Q66H79 Q5XIF6 Q5XIF6 P69897 P69897 P85108 Q6P9T8 D3Z887 F1LQ51 F1M951 P62982 P62982 P62982 P62982 P62982 P62982 P62982 P62982 P62982 P62982 D3ZCY2 D3ZCY2 D3ZYT1 F1LSM0 Q00981 Q00981 B2RZA9 Q9EQX9 F1M403 Q5U300 Q5U300 Q4KM73 Q6AYT3 Q6AYT3 Q4KMA2 D4AD39 Q4KMA2 Q4KMA2 Q4KMA2 Q4KMA2 B2GUV5 D4A133 D4A133 Q6AY86 O08700 O08700 O55166 P63025 P63025 P63025 P63025 P63025 Q9QUL6 P31000 P31000 Q9Z2L0 Q9Z2L0 Q9Z2L0 D4A133 P62815 Q6PCU2 F1LQ45 Q9JJ50 D3ZC84 Q63537 Q5XIC1 B5DF55 P37199 D3ZQ93 P16617 NP_001156745.1 F1LP70 P11506 Q64542-2 P42123 P42123 P68255 P68255 P04797 Q64566 P11980


Trafficking protein particle comFVQDTLK#GDGVTEIR IPI:IPI00004324.1 Similar to trafficking protein paGK#SALLER IPI00177509 Transaldolase SVTK#IYNYYK IPI:IPI00744692.1 VCP/p97 AIGVK#PPR IPI:IPI00022774.3 VCP/p97 ELQELVQYPVEHPDK#FLK IPI:IPI00022774.3 VCP/p97 HPALFK#AIGVKPPR IPI:IPI00022774.3 VCP/p97 SPVAK#DVDLEFLAK IPI:IPI00022774.3 VCP/p97 VAILK#ANLR IPI:IPI00022774.3 VCP/p97 VINQILTEMDGMSTK#K IPI:IPI00022774.3 Transmembrane and ubiquitin LK#FLNDSEQVAR IPI:IPI00027773.3 Triosephosphate isomerase EAGITEK#VVFEQTK IPI:IPI00465028.7 Triosephosphate isomerase LDEREAGITEK#VVFEQTK IPI:IPI00465028.7 Triosephosphate isomerase VVLAYEPVWAIGTGK#TATPQQAQIPI:IPI00465028.7 E3 ligase TRIM32 K#FFTGSLAEVEK IPI:IPI00297113.1 Tubulin alpha-4A chain DVNAAIAAIK#TK IPI:IPI00007750.1 Tubulin alpha-4A chain GHYTIGK#EIIDPVLDR IPI:IPI00007750.1 Tubulin beta-5 chain ISVYYNEATGGK#YVPR IPI:IPI00011654.2 Tubulin beta-5 chain K#LAVNMVPFPR IPI:IPI00011654.2 Tubulin beta-2A chain INVYYNEAAGNK#YVPR IPI:IPI00013475.1 Tubulin beta-4B chain INVYYNEATGGK#YVPR IPI:IPI00007752.1 Uncharacterized protein VEEEIQTLSQVLAAK#EK IPI:IPI00619951.3 Uncharacterized protein DFLK#EFNNK IPI:IPI00784013.1 Uncharacterized protein FVLK#NYGENPEAYNEELK IPI:IPI00034006.1 40S ribosomal protein S27a AK#IQDK#EGIPPDQQR IPI:IPI00179330.6 40S ribosomal protein S27a IQDK#EGIPPDQQR IPI:IPI00179330.6 40S ribosomal protein S27a LIFAGK#QLEDGR IPI:IPI00179330.6 40S ribosomal protein S27a LIFAGK#QLEDGRTLSDYNIQK IPI:IPI00179330.6 40S ribosomal protein S27a MQIFVK#TLTGK IPI:IPI00179330.6 40S ribosomal protein S27a QLEDGRTLSDYNIQK#ESTLHLVL IPI:IPI00179330.6 40S ribosomal protein S27a TITLEVEPSDTIENVK#AK IPI:IPI00179330.6 40S ribosomal protein S27a TLSDYNIQK#ESTLHLVLR IPI:IPI00179330.6 40S ribosomal protein S27a TLTGK#TITLEVEPSDTIENVK IPI:IPI00179330.6 40S ribosomal protein S27a VDENGK#ISR IPI:IPI00179330.6 Ubiquitin carboxyl-terminal hydGLQPGEEELPDISPPIVIPDDSK#DIPI:IPI00024401.4 Ubiquitin carboxyl-terminal hydLK#PMYGPGYTGLK IPI:IPI00024401.4 Ubiquitin specific peptidase 14LQEEITK#QSPTLQR IPI:IPI00219913.1 IPI:IPI00902614.2 Ubiquitin specific peptidase 24MWNK#ELYVR IPI:IPI00018352.1 Ubiquitin carboxyl-terminal hydMQLK#PMEINPEMLNK Ubiquitin carboxyl-terminal hydQIEELK#GQEVSPK IPI:IPI00018352.1 Ubiquitin-conjugating enzyme IEINFPAEYPFK#PPK IPI:IPI00021347.1 Ubiquitin-conjugating enzyme IYHPNVDK#LGR IPI:IPI00003949.1 Ubiquitin-conjugating enzyme VQWYPEGVK#QHVK IPI:IPI00783378.3 Ubiquitin-activating enzyme E ATLPSPDK#LPGFK IPI:IPI00645078.1 Ubiquitin-activating enzyme E YDGQVAVFGSDLQEK#LGK IPI:IPI00645078.1 UMP-CMP kinase K#NPDSQYGELIEK IPI:IPI00219953.5 IPI:IPI00550689.3 tRNA-splicing ligase RtcB homVASPK#LVMEEAPESYK tRNA-splicing ligase RtcB homVEQHVVDGK#ER IPI:IPI00550689.3 RAD23B DAFPVAGQK#LIYAGK IPI:IPI00008219.1 RAD23A TLQQQTFK#IR IPI:IPI00008219.1 RAD23B GK#DAFPVAGQK IPI:IPI00008223.3 RAD23B IDEK#NFVVVMVTKPK IPI:IPI00008223.3 RAD23B IDIDPEETVK#ALK IPI:IPI00008223.3 RAD23B NFVVVMVTK#PK IPI:IPI00008223.3 ATPase, H transporting, lysos A]SQSQGIQQLLQAEK#R IPI00025285 RCG52629 ITLEVAK#LIK IPI00007682 RCG52629 M]DFSK#LPK IPI00007682 Vacuolar protein sorting-assocYEIMDGAPVK#GESIPIR IPI:IPI00411426.3 Vacuolar protein sorting-assocLK#ENLYPYLGPSTLR IPI00090327 IPI00090327 Vacuolar protein sorting-assocVPGISK#DLR Vacuolar protein sorting-assocAADDSK#EVESFQQLLNAR IPI:IPI00166132.3 Vesicle-associated membraneADALQAGASQFETSAAK#LK IPI:IPI00549343.3 Vesicle-associated membraneDQK#LSELDDR IPI:IPI00549343.3 Vesicle-associated membraneDQK#LSELDDRADALQAGASQFEIPI:IPI00549343.3 Vesicle-associated membraneLSELDDRADALQAGASQFETSAA IPI:IPI00549343.3 Vesicle-associated membraneVNVDK#VLER IPI:IPI00549343.3 NSF, vesicle-fusing ATPase VLDDGELLVQQTK#NSDR IPI:IPI00006451.6 Vimentin LREK#LQEEMLQR IPI:IPI00418471.6 Vimentin QVDQLTNDK#AR IPI:IPI00418471.6 IPI:IPI00216308.5 Voltage-dependent anion-seleDVFTK#GYGFGLIK Voltage-dependent anion-seleNVNAGGHK#LGLGLEFQA IPI:IPI00216308.5 Voltage-dependent anion-seleTK#SENGLEFTSSGSANTETTK IPI:IPI00216308.5 RCG52629 LIK#DDFLQQNGYTPYDR IPI:IPI00007682.2 V-type proton ATPase subunitAVVQVFEGTSGIDAK#K IPI:IPI00007812.1 V-type proton ATPase subunitK#QDFPLVK IPI:IPI00003856.1 Uncharacterized protein GSSQPNLSTSYSEQEYGK#AGGSIPI:IPI00397381.5 Hepatocyte growth factor-reguKAEGK#AASTTELPPEYLTSPLSQIPI:IPI00006176.3 Ubiquitin specific peptidase 9, QDNESNVDPRDDVFGYPQQFED IPI00221012 Synapsin-2 TPALSPQRPLTTQQPQSGTLK#E IPI:IPI00023302.2 Mannose-1-phosphate guanyl VAPSAVLGPNVSIGK#GVTIGEGVIPI:IPI00101782.3 Stam1 (SH3 and VHS domain ASPALVAK#DPGTVATKKEEEDLAIPI:IPI00020178.1 Nuclear pore complex protein NSQFSGGPLGNPNTTAK#VQQR IPI:IPI00026625.1 Uncharacterized protein NYGSYSTQATAAAATAELLK#K IPI:IPI00306382.2 Phosphoglycerate kinase 1 VLNNMEIGTSLYDEEGAK#IVK IPI:IPI00169383.3 c-Maf-inducing protein QIEETK#PLLGSDVSAPEGTK IPI:IPI00028438.4 Uncharacterized protein SK#ASLNPNDLGPLPPGWEER IPI:IPI00023287.4 Plasma membrane calcium-traSVDK#DPMLLSGTHVMEGSGR IPI:IPI00217169.1 Isoform XA of Plasma membraTLDK#DPMLLSGTHVMEGSGR IPI:IPI00217169.1 L-lactate dehydrogenase B ch GLTSVINQK#LKDDEVAQLRK IPI:IPI00219217.3 L-lactate dehydrogenase B ch GLTSVINQKLK#DDEVAQLRK IPI:IPI00219217.3 14-3-3 protein theta K#QTIENSQGAYQEAFDISK IPI:IPI00018146.1 14-3-3 protein theta QTIENSQGAYQEAFDISK#K IPI:IPI00018146.1 Glyceraldehyde-3-phosphate dGAAQNIIPASTGAAK#AVGK IPI:IPI00219018.7 Calcium-transporting ATPase FQK#IPNVENETMIPVLTSK IPI:IPI00220473.2 Pyruvate kinase isozymes M1 GADYLVTEVENGGSLGSK#K IPI:IPI00479186.7

Trafficking protein particle com FVQDTLK#GDGVTEIR Trafficking protein particle com GK#SALLER Transaldolase SVTK#IYNYYK Transitional endoplasmic reticuAIGVK#PPR Transitional endoplasmic reticuELQELVQYPVEHPDK#FLK Transitional endoplasmic reticuHPALFK#AIGVKPPR Transitional endoplasmic reticuSPVAK#DVDLEFLAK Transitional endoplasmic reticuVAILK#ANLR Transitional endoplasmic reticuVINQILTEMDGMSTK#K Transmembrane and ubiquitin- LK#FLNDSEQVAR triosephosphate isomerase 1 isEAGITEK#VVFEQTK triosephosphate isomerase 1 isLDEREAGITEK#VVFEQTK triosephosphate isomerase 1 isVVLAYEPVWAIGTGK#TATPQQA Tripartite motif-containing proteK#FFTGSLAEVEK Tubulin alpha-4A chain DVNAAIAAIK#TK Tubulin alpha-4A chain GHYTIGK#EIIDPVLDR Tubulin beta chain ISVYYNEATGGK#YVPR Tubulin beta chain K#LAVNMVPFPR Tubulin beta-2A chain INVYYNEAAGNK#YVPR Tubulin beta-2C chain INVYYNEATGGK#YVPR tumor protein D52 isoform 2 VEEEIQTLSQVLAAK#EK Tyrosine-protein kinase JAK1 DFLK#EFNNK Tyrosine-protein phosphatase nFVLK#NYGENPEAYNEELK ubiquitin and ribosomal protein AK#IQDK#EGIPPDQQR ubiquitin and ribosomal protein IQDK#EGIPPDQQR ubiquitin and ribosomal protein LIFAGK#QLEDGR ubiquitin and ribosomal protein LIFAGK#QLEDGRTLSDYNIQK ubiquitin and ribosomal protein MQIFVK#TLTGK#TITLEVEPSDT ubiquitin and ribosomal protein LIFAGKQLEDGRTLSDYNIQK#ES ubiquitin and ribosomal protein TITLEVEPSDTIENVK#AK#IQDK ubiquitin and ribosomal protein TLSDYNIQK#ESTLHLVLR ubiquitin and ribosomal protein TLTGK#TITLEVEPSDTIENVK#AK ubiquitin and ribosomal protein YYKVDENGK#ISR Ubiquitin carboxyl-terminal hyd GLQPGEEELPDISPPIVIPDDSK# Ubiquitin carboxyl-terminal hyd LK#PMYGPGYTGLK Ubiquitin carboxyl-terminal hyd LQEEITK#QSPTLQR Ubiquitin carboxyl-terminal hyd MWNK#ELYVR Ubiquitin carboxyl-terminal hyd MQLK#PMEINPEMLNK Ubiquitin carboxyl-terminal hyd QIEELK#GQEVSPK Ubiquitin-conjugating enzyme EIEINFPAEYPFK#PPK Ubiquitin-conjugating enzyme EIYHPNVDK#LGR Ubiquitin-conjugating enzyme EVQWYPEGVK#QHVK Ubiquitin-like modifier-activatingATLPSPDK#LPGFK Ubiquitin-like modifier-activatingYDGQVAVFGSDLQEK#LGK UMP-CMP kinase 1 isoform a K#NPDSQYGELIEK UPF0027 protein C22orf28 VASPK#LVMEEAPESYK UPF0027 protein C22orf28 VEQHVVDGK#ER UV excision repair protein RADDAFPVAGQK#LIYAGK UV excision repair protein RADTLQQQTFK#IR UV excision repair protein RADGK#DAFPVAGQK UV excision repair protein RADIDEK#NFVVVMVTKPK UV excision repair protein RADIDIDPEETVK#ALK UV excision repair protein RADNFVVVMVTK#PK Vacuolar ATP synthase subuni A]SQSQGIQQLLQAEK#R Vacuolar ATPase isoform VA68ITLEVAK#LIK Vacuolar ATPase isoform VA68M]DFSK#LPK Vacuolar protein sorting-associ YEIMDGAPVK#GESIPIR Vacuolar protein sorting-associ LK#ENLYPYLGPSTLR Vacuolar protein sorting-associ VPGISK#DLR Vacuolar protein sorting-associ AADDSK#EVESFQQLLNAR Vesicle-associated membrane ADALQAGASQFETSAAK#LK Vesicle-associated membrane DQK#LSELDDRADALQAGASQFE Vesicle-associated membrane DQK#LSELDDRADALQAGASQFE Vesicle-associated membrane LSELDDRADALQAGASQFETSAA Vesicle-associated membrane VNVDK#VLER Vesicle-fusing ATPase VLDDGELLVQQTK#NSDR Vimentin LREK#LQEEMLQR Vimentin RQVDQLTNDK#AR Voltage-dependent anion-selecDVFTK#GYGFGLIK Voltage-dependent anion-selecNVNAGGHK#LGLGLEFQA Voltage-dependent anion-selecTK#SENGLEFTSSGSANTETTK V-type proton ATPase catalytic LIK#DDFLQQNGYTPYDR V-type proton ATPase subunit AVVQVFEGTSGIDAK#K V-type proton ATPase subunit K#QDFPLVK epsin 2 isoform a GSSQPNLSTSHSEQEYGK#AGG Isoform 1 of Hepatocyte growthKAEGK#ATSTTELPPEYLTSPLSQ Deubiquitinating enzyme FAF-XQDNESNVDPRDDVFGYPQQFED Isoform IIa of Synapsin-2 TPALSPQRPLTTQQPQSGTLK#D Isoform 1 of Mannose-1-phosp VAPSAVLGPNVSIGK#GVTVGEG Isoform 1 of Signal transducingASPALVAK#DPGTVANKKEEEDL Isoform 1 of Nuclear pore compNSQFAGGPLGNPNTTAK#VQQR Isoform 1 of Secretory carrier-aNYGSYSTQASAAAATAELLK#K Phosphoglycerate kinase 1 VLNNMEIGTSLFDEEGAK#IVK c-Maf-inducing protein isoform QIEETK#PLLGGDVSAPEGTK Isoform 4 of E3 ubiquitin-protei SK#TSLNPNDLGPLPPGWEER Isoform XB of Plasma membra SLDK#DPMLLSGTHVMEGSGR Isoform XB of Plasma membra SLDK#DPMLLSGTHVMEGSGR L-lactate dehydrogenase B chaGLTSVINQK#LKDDEVAQLKK L-lactate dehydrogenase B chaGLTSVINQKLK#DDEVAQLKK 14-3-3 protein theta K#QTIDNSQGAYQEAFDISK 14-3-3 protein theta QTIDNSQGAYQEAFDISK#K Glyceraldehyde-3-phosphate d GALQNIIPASTGAAK#AVGK Isoform 2 of Calcium-transporti FQK#IPNGENETMIPVLTSK Isoform M2 of Pyruvate kinase GADFLVTEVENGGSLGSK#K


100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 97 97 96 96 96 96 95 95 95 95 95 95 95 95 95 95 95 95 95 95


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

Q6AY24 D3Z9C0 P48037 Q9ESR9 D4ACN3 Q66HA8 Q64542-2 Q9JJ19 XP_001057026.1 D3ZC84 Q5U300 P06685 B2GUU9 P60905 Q8R3Z7 G3V7G8 B0BN93 Q9JHW5 Q9R1Z0 D3ZSP5 D4AA63 P13233 P13233 P06685 F1M0K5 Q9Z2Q7 P14668 Q64654 O88600 B5DF55 B5DF55 B5DF55 P23347 G3V6S0 P48450 B4F7D6 F1LP89 D3ZA14 P63322 NP_001099903.1 D3Z9G0 Q00981 P31000 Q5U2U6 D4A6X4 Q6MG60 B2RYA8 F1LPB1 D3ZE47 XP_001073579.1 A1L134 P06685 P11980 D3ZYX5 F1M7W7 P31662 D3ZHJ1 Q4KMA2 Q5XIJ5 D3ZPP2 Q63060 B3GNI6 P05197 P59215 Q792H5 P63004 F1LTW9 P56603 Q9R1Z0 D3ZYX5 P62749 Q9QZA2 P48500 Q63666 P35427 P21533 D4A0E8 P11275 D3ZJX3 P21575 P63170 Q91XV6 P16970 P63004 P06686 D3ZVQ0 Q5FVI3 P04642 P42123 Q6P501 P70550 A2RRU2 P13233 P35427

BMSC-UbP, ubiquitin-like 7 SWPEPDQKPEPVDK#VAALR IPI:IPI00305922.5 Uncharacterized protein HNWSGLDK#QTDIQNLNEER IPI00301987 Annexin A6 TNEQIHQLVAAYK#DAYER IPI:IPI00002459.4 ATP-binding cassette sub-famLPVSTK#PVEDDVDVASER IPI:IPI00307592.6 E3 ligase HERC2 TPLDK#DLINTGIYESSGK IPI00005826 Heat shock protein 105 kDa ENLSYDLVPMK#NGGVGIK IPI:IPI00218993.1 Isoform XA of Plasma membraTSPVEGLSGNPADLEK#RR IPI:IPI00217169.1 IPI:IPI00003527.5 Na(+)/H(+) exchange regulato LVEPGSPAEK#SGLLAGDR PREDICTED: ribosomal prote TLSDYNIQK#ESMLHLVLR IPI:IPI00179330.6 Ubiquitin specific peptidase 9, DDVFGYPQQFEDK#PPLSK IPI:IPI00003964.4 Ubiquitin-activating enzyme E QPAENVNQYLTDSK#FVER IPI:IPI00645078.1 IPI00646182 Sodium/potassium-transportin EVSMDDHK#LSLDELHRK Cryptochrome 2 (Photolyase-l YIYEPWNAPESVQK#AAK IPI:IPI00216898.2 IPI00402231 DnaJ homolog subfamily C meFK#EINNAHAILTDATKR EH-domain containing 4 SISIIDSPGILSGEK#QR IPI:IPI00005578.1 IPI:IPI00783097.3 Glycine-tRNA ligase (RCG525YPLFEGQETGKK#ETVEE Proteasome 26S subunit, rpn9TAIGALK#LNIGDLQATK IPI:IPI00549672.2 Vesicle-associated membraneVTETQAQVDELK#GIMVR IPI:IPI00020887.3 IPI:IPI00031804.1 Voltage-dependent anion-seleNFNAGGHK#VGLGFELEA Uncharacterized protein VANATK#IALYETPTGWK IPI:IPI00217872.3 Ubiquilin 2 (Predicted) EK#EEFAVPENSTVQQFK IPI:IPI00071180.1 IPI:IPI00220993.1 2',3'-cyclic-nucleotide 3'-phospAGQVFLEELGNHK#AFKK IPI:IPI00220993.1 2',3'-cyclic-nucleotide 3'-phospKAGQVFLEELGNHK#AFK IPI:IPI00006482.1 Sodium/potassium-transportin K#ADIGVAMGIVGSDVSK Uncharacterized protein (Frag AGPVAVAPELESK#ESVL IPI:IPI00015476.1 Syntaxin-8 LLLASFK#NEGSEPDLIR IPI:IPI00009225.1 Annexin A5 GAGTDEK#VLTEIIASR IPI:IPI00329801.1 Lanosterol 14-alpha demethyl GVAYDVPNAVFLEQK#K IPI:IPI00295772.5 Heat shock 70 kDa protein 4 LNLQNK#QSLTADPVVK IPI:IPI00002966.2 IPI:IPI00020178.1 Stam1 (SH3 and VHS domain ASPALVAK#DPGTVATK IPI:IPI00020178.1 Stam1 (SH3 and VHS domain DPGTVATK#KEEEDLAK IPI:IPI00020178.1 Stam1 (SH3 and VHS domain DPGTVATKK#EEEDLAK Anion exchange protein 2 LLPPGAGLEPK#SAQDK IPI:IPI00383597.2 Spectrin beta 2, isoform CRA_AK#SALPAQSAATLPAR IPI:IPI00005614.6 Lanosterol synthase LSQVPDNNPDYQK#YYR IPI:IPI00009747.1 Stk11ip protein K#LYLEGNPLWFHPAHR IPI00170934 Uncharacterized protein (Frag RLK#SSTSFANIQENST IPI:IPI00329054.1 Protein Efr3a ADMEK#LTFYAVSAPEK IPI00470711 Ras-related protein Ral-A ADQWNVNYVETSAK#TR IPI:IPI00217519.3 spartin IQPEEK#PVEVSPAVTR IPI00430622 Tnf receptor-associated factor VTELESVDK#SAGQAAR IPI:IPI00297473.2 IPI:IPI00018352.1 Ubiquitin carboxyl-terminal hydM]QLK#PMEINPEMLNK Vimentin ETNLESLPLVDTHSK#R IPI00418471 LITAF-like protein S]NEPPPPYPGGPTAPLLEEK#SGIPI00872741 Acylphosphatase GTVQGQLQGPVSK#VR IPI:IPI00221117.3 IPI00000760 N(G),N(G)-dimethylarginine di TVVAGSSEAAQK#AVR LOC689593 protein EVAEAYEVLSDK#HKR IPI00220102 Uncharacterized protein (Frag LSQNK#QAVEGLGDLK IPI:IPI00021808.3 Uncharacterized protein K#TTEEEEEDELHIGR IPI:IPI00005774.5 IPI:IPI00098523.1 PREDICTED: DnaJ (Hsp40) hQVAEAYEVLSDAK#KR Ancient ubiquitous protein 1 VQQLVAK#ELGQIGTR IPI:IPI00001891.1 Sodium/potassium-transportin DK#YEPAAVSEHGDKK IPI:IPI00006482.1 Pyruvate kinase isozymes M1 IYVDDGLISLQVK#EK IPI:IPI00479186.7 Uncharacterized protein RGPAVQATK#AAAGTK IPI:IPI00844172.1 Uncharacterized protein GTIPDMIADSSK#YIK IPI:IPI00018968.2 Sodium-dependent neutral amQSVLNVAGETGGK#QK IPI:IPI00335355.3 Phosphoserine aminotransferaNNGGAAAMEK#LSSVK IPI:IPI00001734.3 RAD23B LIYAGK#ILSDDTALK IPI:IPI00008223.3 Abhydrolase domain-containinELDTIEVFVTK#SAR IPI00740229 Similar to ADP-ribosylation facDLAGALDEK#ELIEK IPI:IPI00060031.3 Glycerol kinase DNLGIIK#SSEEIEK IPI00216067 Septin-11 KLDSK#VNIIPIIAK IPI00550119 Elongation factor 2 FAAK#GEGQLGAAER IPI:IPI00186290.6 Guanine nucleotide-binding prDVK#LLLLGAGESGK IPI:IPI00337415.9 CUGBP Elav-like family membK#AALEAQNALHNIK IPI:IPI00034015.1 IPI:IPI00218728.4 Platelet-activating factor acetyK#EAELDMNEELDKK Uncharacterized protein (Frag LTFYALSAPEK#LDR IPI:IPI00470711.4 Secretory carrier-associated mTVQTAAANAASTAATSAAQNAFK IPI:IPI00005129.8 Voltage-dependent anion-seleLTVDTIFVPNTGK#K IPI:IPI00031804.1 Uncharacterized protein GPAVQATK#AAAGTK IPI:IPI00844172.1 Hippocalcin-like protein 1 K#IYANFFPYGDASK IPI00555920 Programmed cell death 6-interAVLDK#AVQADGQVK IPI:IPI00246058.9 Triosephosphate isomerase VVFEQTK#AIADNVK IPI00465028 Vesicle-associated membraneDQK#LSELDDRADALQAGASVFE IPI:IPI00549343.3 60S ribosomal protein L13a YQAVTATLEEK#RK IPI:IPI00304612.9 60S ribosomal protein L6 VLATVTK#TVGGDK IPI:IPI00329389.8 Protein arginine N-methyltransLSPWIHPDSK#VEK IPI00441473 CaMKII subunit alpha DLINK#MLTINPSK IPI00654569 Uncharacterized protein RSIQK#LLEWENNR IPI:IPI00015878.1 Dynamin-1 EISYAIK#NIHGIR IPI00033022 Dynein light chain 1, cytoplasmYNIEK#DIAAHIKK IPI:IPI00019329.1 FXYD domain-containing ion t APGDEEAQVENLITTNAAEPQK#AIPI:IPI00004367.3 ATP-binding cassette sub-famMTIMEQK#YEGEYR IPI:IPI00002372.1 Platelet-activating factor acetyK#EAELDMNEELDK IPI:IPI00218728.4 Sodium/potassium-transportin RYPGGWVEK#ETYY IPI:IPI00006482.1 Ubiquitin specific peptidase 5 HAFNLK#QLDNPAR IPI:IPI00024664.1 Leucine-rich repeat-containingHLDVVDLSK#NQIR IPI:IPI00470576.4 L-lactate dehydrogenase A ch QVVDSAYEVIK#LK IPI:IPI00217966.8 L-lactate dehydrogenase B ch MVVDSAYEVIK#LK IPI:IPI00219217.3 Lysosomal-associated transm IPEK#EPPPPYLPA IPI:IPI00014172.1 Ras-related protein Rab-8B ERGEK#LAIDYGIK IPI:IPI00028481.1 RCG26229, isoform CRA_a SPGSSALPK#QPER IPI00016455 2',3'-cyclic-nucleotide 3'-phospNQWQLSLDDLK#K IPI00306667 60S ribosomal protein L13a VLDGIPPPYDK#K IPI:IPI00304612.9

Ubiquitin-like protein 7 KSWPEPDQKPEPVDK#VAAMR WD repeat-containing protein mHNWSGLDK#QSDIQNLNEER annexin VI isoform 2 TNEQMHQLVAAYK#DAYER ATP-binding cassette, sub-fam MPVSTK#PVEDDVDVASER HECT domain and RCC1-like dTPLDK#DLINTGICESSGK Isoform Beta of Heat shock proENLSYDLVPLK#NGGVGIK Isoform XB of Plasma membra TSPVEGLSGNPADLEK#R Na(+)/H(+) exchange regulator LVEPGSPAEK#AGLLAGDR ubiquitin and ribosomal protein TLSDYNIQK#ESTLHLVLR ubiquitin specific protease 9, X-DDVFGYPQQFEDK#PALSK Ubiquitin-like modifier-activatingQPAENVNQYLTDPK#FVER cDNA FLJ55427, highly similar EVSMDDHK#LSLDELHR cryptochrome 2 (photolyase-lik YIYEPWNAPESIQK#AAK Cysteine string protein;DnaJ hoFK#EINNAHAILTDATK EH domain-containing protein 4SISVIDSPGILSGEK#QR Glycyl-tRNA synthetase YPLFEGQETGKK#ETIEE HSPC027 TAIGALK#LNIGDLQVTK Isoform 1 of Vesicle-associatedVMETQAQVDELK#GIMVR Isoform 1 of Voltage-dependen NFSAGGHK#VGLGFELEA Isoform 2 of PhosphoglucomutaVASATK#IALYETPTGWK Isoform 2 of Ubiquilin-1 EK#EEFAVPENSSVQQFK Isoform CNPI of 2',3'-cyclic-nucAGQVFLEELGNHK#AFK Isoform CNPI of 2',3'-cyclic-nucAGQVFLEELGNHK#AFK Isoform Long of Sodium/potassK#ADIGVAMGIAGSDVSK Neutral amino acid transporter SEEETSPLVTHQNPAGPVASAPE Syntaxin-8 LLLASFK#NEGAEPDLIR Annexin A5 GAGTNEK#VLTEIIASR cytochrome P450, family 51, suGVAYDVPNPVFLEQK#K Heat shock 70 kDa protein 4 LNLQNK#QSLTMDPVVK Isoform 1 of Signal transducingASPALVAK#DPGTVANK Isoform 1 of Signal transducingDPGTVANK#KEEEDLAK Isoform 1 of Signal transducingDPGTVANKK#EEEDLAK Isoform A of Anion exchange p LLPTGAGLEPK#SAQDK Isoform Long of Spectrin beta cAK#TALPAQSAATLPAR Lanosterol synthase LSQVPDNPPDYQK#YYR LKB1-interacting protein 1;Seri K#LYLEGNPLWFHPEHR Osteopetrosis-associated transRLK#SSTSFANIQENSN Protein EFR3 homolog A;Prote TDMEK#LTFYAVSAPEK Ras-related protein Ral-A AEQWNVNYVETSAK#TR Spartin;Spastic paraplegia 20 pIQPEEK#PVEVSPAVTK TNF receptor-associated factorVTELESVDK#SAGQVAR Ubiquitin carboxyl-terminal hyd MQLK#PMEINPEMLNK Vimentin;Vimentin variant 3;VimETNLDSLPLVDTHSK#R LITAF-like protein;Uncharacter S]SEPPPPYPGGPTAPLLEEK#SG Acylphosphatase-1 GTVQGQLQGPISK#VR DDAHII;Dimethylargininase-2;NTVVAGSSDAAQK#AVR DnaJ homolog subfamily B me EVAEAYEVLSDK#HK Histidyl-tRNA synthetase, cytopLSQNK#QALEGLGDLK Isoform 1 of Low-density lipopr K#TTEEEDEDELHIGR Isoform B of DnaJ homolog subQVAEAYEVLSDAK#K Isoform Long of Ancient ubiquitVQQLVAK#ELGQTGTR Isoform Long of Sodium/potassDK#YEPAAVSEQGDKK Isoform M2 of Pyruvate kinase IYVDDGLISLQVK#QK Myosin RGPAVLATK#AAAGTK NEDD8-activating enzyme E1 rGTIPDMIADSGK#YIK Orphan sodium- and chloride-dQSVLNVAGEAGGK#QK Phosphoserine aminotransfera NNGGAAAMEK#LSSIK UV excision repair protein RADLIYAGK#ILNDDTALK Abhydrolase domain-containingELDTIEVFPTK#SAR ADP-ribosylation factor-like proDLPGALDEK#ELIEK ATP:glycerol 3-phosphotransfe DNLGIIK#TSEEIEK cDNA FLJ58821, highly similar LDSK#VNIIPIIAK Elongation factor 2 FAAK#GEGQLGPAER Guanine nucleotide-binding proEVK#LLLLGAGESGK Isoform 1 of CUG-BP- and ETRK#AALEAQNALHNMK Isoform 1 of Platelet-activating K#EAELDVNEELDKK Isoform 1 of Protein EFR3 homLTFYAVSAPEK#LDR Isoform 1 of Secretory carrier-aTVQTAAANAASTAASSAAQNAFK Isoform 1 of Voltage-dependen LTLDTIFVPNTGK#K Myosin GPAVLATK#AAAGTK Neurocalcin delta variant;NeuroK#IYGNFFPYGDASK PDCD6IP protein TVLDK#AVQADGQVK Triosephosphate isomerase;Tr VVFEQTK#VIADNVK Vesicle-associated membrane DQK#LSELDDRADALQAGASQFE 60S ribosomal protein L13a YQAVTATLEEK#R 60S ribosomal protein L6 VLATVTK#PVGGDK 72 kDa ICln-binding protein;HisLSPWIRPDSK#VEK Calcium/calmodulin-dependent DLINK#MLTINPAK Cysteine-rich hydrophobic domRSIEK#LLEWENNR Dynamin-2;cDNA FLJ40556 fis EISYAIK#NIHGVR Dynein light chain 1, cytoplasmYNIEK#DIAAHIK FXYD domain-containing ion tr APGDEEAQVENLITANATEPQK# Isoform 1 of ATP-binding casseMTITEQK#YEGEYR Isoform 1 of Platelet-activating K#EAELDVNEELDKK Isoform Long of Sodium/potassRRPGGWVEK#ETYY Isoform Long of Ubiquitin carboHAFSLK#QLDNPAR Leucine-rich repeat-containing HLDVMDLSK#NQIR L-lactate dehydrogenase QVVESAYEVIK#LK L-lactate dehydrogenase B chaMVVESAYEVIK#LK Lysosomal-associated transmeMPEK#EPPPPYLPA Ras-related protein Rab-8A ERGEK#LALDYGIK Transmembrane protein 127 SPGGSALPK#QPER 2',3'-cyclic-nucleotide 3'-phosphNQWQLSADDLK#K 60S ribosomal protein L13a VFDGIPPPYDK#K


Page 56 of 60

95 95 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 94 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 93 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92 92

Page 57 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

F1M3Z1 P05065 P04797 G3V6T1 D3ZJX3 D4A1B8 XP_001073579.1 P06687 B2GUZ1 F1LQ51 P25113 P11506 Q9EQS0 D3ZTP3 F1M516 Q498C7 Q4KMA2 D3ZG78 P27952 P47860 O88989 P04797 D3ZMS4 P11506 P50398 D4AD79 P31000 D3ZG78 D4A1Y4 F1M8R8 P27952 P30835 P16617 P47942 Q62658 P10824 P63018 Q5XI55 D3Z8A4 P11167 Q6P791 P50137 Q9EPF2 D4A383 F1M0K5 F1M516 P47860 P07335 P11275 Q62951 P05065 P05065 Q64598 D3ZWE0 Q62835 B5DF55 P04764 P06686 P06686 P06686 Q64542-2 P47819 P12839 Q05982 Q5XI20 Q8VIL3 P28480 P06686 G3V8Q8 Q5XIQ4 Q9WU34 O09032 Q5HZE8 P06685 P16617 D4A3D8 D3ZGD3 E9PTX9 E9PTX9 P14925 D3ZLR7 D3ZH36 P04642 O88989 D4AD40 D3ZME8 P04692 D3ZUV2 P11275 P13233 F1LRL9 Q64568-10 D3ZWP6 Q03114


Uncharacterized protein (Frag NFGIGQDLQPK#R IPI:IPI00299573.1 Fructose-bisphosphate aldolasENLK#AAQEEYIK IPI:IPI00465439.5 IPI:IPI00219018.7 Glyceraldehyde-3-phosphate dKVVK#QAAEGPLK RCG20221, isoform CRA_b GFFEGSIASK#GK IPI:IPI00295857.7 Uncharacterized protein SIQK#LLEWENNR IPI:IPI00479473.2 RCG55152, isoform CRA_a VQVALGNIASK#R IPI:IPI00013654.1 PREDICTED: DnaJ (Hsp40) hSLTINGK#EHLLR IPI:IPI00098523.1 IPI:IPI00006482.1 Sodium/potassium-transportin NPGGWVEK#ETYY Ubiquitin carboxyl-terminal hydDK#LDTVVEFPVR IPI:IPI00011836.2 Uncharacterized protein RYIPETLNK#SIR IPI00784013 Phosphoglycerate mutase 1 AMEAVAAQGK#VK IPI:IPI00549725.6 Plasma membrane calcium-traILPPEK#EGALPR IPI00021695 Transaldolase IIELYK#EAGISK IPI:IPI00744692.1 RCG50292, isoform CRA_a SQTEEHEEAGPLPTK#VNLAHSE IPI:IPI00399320.4 Uncharacterized protein (Frag LIFAGK#QPEDGR IPI:IPI00179330.6 Uncharacterized protein C4orfGSSLPGK#PSSPHSGQDPPAPPVIPI:IPI00044965.3 RAD23B ILSDDTALK#EYK IPI:IPI00008223.3 Uncharacterized protein KTDSFFLEVQK#R IPI00385631 40S ribosomal protein S2 AEDK#EWIPVTK IPI:IPI00013485.3 IPI:IPI00009790.1 6-phosphofructokinase type C SFEGNLNTYK#R IPI00916111 Malate dehydrogenase, cytoplSQGAALEK#YAK Glyceraldehyde-3-phosphate dVVK#QAAEGPLK IPI:IPI00219018.7 IPI00007913 Rho GTPase activating proteinTVTSALK#TYLR IPI00021695 Plasma membrane calcium-traIEQEQK#FTVVR Rab GDP dissociation inhibito K#QNDVFGEADQ IPI:IPI00010154.3 Uncharacterized protein SVTLLVK#GPNK IPI:IPI00027626.3 Vimentin RTLLIK#TVETR IPI:IPI00418471.6 Uncharacterized protein TDSFFLEVQK#R IPI00385631 Uncharacterized protein GVK#YEAPQTTDGLAGALDAR IPI:IPI00023191.5 Uncharacterized protein (Frag SK#LLSPYSPQTQETDSTGQK IPI:IPI00465045.2 40S ribosomal protein S2 EWIPVTK#LGR IPI00013485;IPI00943304 IPI00332371 6-phosphofructokinase, liver tyA]TVDLEK#LR Phosphoglycerate kinase 1 AEPAK#IDAFR IPI00169383 Dihydropyrimidinase-related p K#PFPDFVYKR IPI00257508 Peptidyl-prolyl cis-trans isome FTLGK#QEVIR IPI00413778 Guanine nucleotide-binding prLK#IDFGDAAR IPI:IPI00337415.9 IPI00304925 Hsc70, heat shock cognate 71GRLSK#EDIER Peptide-N(4)-(N-acetyl-beta-g ETINGLNK#QR IPI:IPI00074605.2 Similar to mKIAA0738 protein MYLSK#GPNVK IPI:IPI00006050.4 Solute carrier family 2, facilitatDLQEMK#EEGR IPI:IPI00220194.6 Ragulator complex protein LA LLLDPSNTPTK#ALNGAEPSYHSLIPI:IPI00016670.3 Transketolase GITGIEDK#EAWHGKPLPK IPI00643920 Cell surface glycoprotein MUCSDK#LPEEMALLQGSNGDK IPI:IPI00016334.2 Tweety homolog 3 (DrosophilaAK#YLATSQPRPDSSGSGH IPI:IPI00749429.1 IPI:IPI00015476.1 Uncharacterized protein (Frag KGEQELQEVK#VEAIPNSK IPI:IPI00179330.6 Uncharacterized protein (Frag TIMLEVEPSDTIEDVK#AK 6-phosphofructokinase type C NFGTK#ISAK IPI:IPI00009790.1 Creatine kinase B-type LPHLGK#HEK IPI00022977 CaMKII subunit alpha MLTINPSK#R IPI00221305 IPI00257508 Dihydropyrimidinase-related p K#TFPDFVYK Fructose-bisphosphate aldolasAAQEEYIK#R IPI:IPI00465439.5 Fructose-bisphosphate aldolasK#ELADIAHR IPI00796333 Histone H2A type 1-F K#TESHHKPK IPI:IPI00081836.3 Histone H2A K#TDSHKPGK IPI:IPI00216730.3 Rab GTPase-binding effector DSISSYETQIAALK#QER IPI:IPI00412499.1 IPI:IPI00020178.1 Stam1 (SH3 and VHS domain DPGTVATK#K Alpha-enolase K#LNVVEQEK IPI:IPI00465248.5 Sodium/potassium-transportin K#ADIGIAMGISGSDVSK IPI:IPI00006482.1 IPI:IPI00006482.1 Sodium/potassium-transportin K#EVAMDDHK Sodium/potassium-transportin SSK#IMDSFK IPI:IPI00006482.1 Isoform XA of Plasma membraTQDGVALEIQPLNSQEGLDSEEK#IPI:IPI00217169.1 Glial fibrillary acidic protein K#LLEGEENR IPI:IPI00554648.3 Neurofilament medium polype K#LLEGEETR IPI:IPI00554648.3 Nucleoside diphosphate kinas FIQASEDLLK#EHYIDLK IPI:IPI00604590.3 UPF0452 protein C7orf41 homK#TLQEVLEK IPI00879468 ZW10 interactor AFEQLEAK#K IPI:IPI00294008.4 T-complex protein 1 subunit a LHPESKDDK#HGGYENAVHSGALIPI:IPI00290566.1 Sodium/potassium-transportin EVAMDDHK#LSLDELGR IPI00646182 RCG40648, isoform CRA_b IVESPEFSK#DEDYLGK IPI:IPI00026969.4 E3 ubiquitin-protein ligase MGYK#DDTDSPTEDGEKPR IPI:IPI00297251.3 Neuronal-specific septin-3 VRK#ELEVNGIEFYPQK IPI00384187 ELAV-like protein 4 FANNPSQK#SSQALLSQLYQSPN IPI00644008 Transmembrane protein 59-likLK#LDLTTL IPI00015877 Sodium/potassium-transportin YQLSIHK#NPNASEPK IPI00646182 Phosphoglycerate kinase 1 IVK#DLMAK IPI00169383 Uncharacterized protein AVEIEIETPEQAK#AR IPI:IPI00156793.5 Uncharacterized protein EK#LLETLR IPI:IPI00005024.3 Protein Slc12a2 ESK#GPVAPLNVADQK IPI:IPI00022649.3 Protein Slc12a2 SPGTK#DVVVNVDYSK IPI:IPI00022649.3 Peptidyl-glycine alpha-amidati K#LESSSGR IPI:IPI00878690.1 Uncharacterized protein ALVDALK#K IPI:IPI00295503.2 Uncharacterized protein LPASK#GLEAGLDTPK IPI:IPI00289849.6 L-lactate dehydrogenase A ch TPK#IVSSK IPI:IPI00217966.8 Malate dehydrogenase, cytoplAK#SQIALK IPI:IPI00291005.8 Regulator of chromosome conNNLLSPTQIMVEK#ER IPI:IPI00329626.3 NAD-dependent deacetylase sNLFTQTLGLGSQK#ER IPI00872344 Tropomyosin alpha-1 chain TVTNNLK#SLEAQAEK IPI:IPI00646748.1 E3 ligase mindbomb 1 SSEEPSDDISSGNIPVLQK#DK IPI:IPI00183054.1 CaMKII subunit alpha DLINK#MLTINPSKR IPI00654569 2',3'-cyclic-nucleotide 3'-phospMVSADAYK#IIPGSR IPI:IPI00220993.1 MAP1 light chain LC1 TPEVSGYTYEK#TER IPI00008868 IPI00021695 Isoform ZE of Plasma membraGEIEQERLDK#VWPK Uncharacterized protein QLLSDLIDK#NLENK IPI00552671 Cyclin-dependent kinase 5 N@GELK#LADFGLAR IPI:IPI00376955.3

60S ribosomal protein L7a NFGIGQDIQPK#R Fructose-bisphosphate aldolas ENLK#AAQEEYVK Glyceraldehyde-3-phosphate d KVVK#QASEGPLK Isoform 1 of Coatomer subunit GFFEGTIASK#GK Isoform 1 of Cysteine-rich hydr SIQK#LIEWENNR Isoform 2 of Dynactin subunit 3VQVALGNISSK#R Isoform B of DnaJ homolog subSLTINGK#EQLLR Isoform Long of Sodium/potassRPGGWVEK#ETYY Isoform UNPEL of Ubiquitin ca DK#LDTVVEFPIR Janus kinase 1;Tyrosine-protei YIPETLNK#SIR Phosphoglycerate mutase 1 AMEAVAAQGK#AK Plasma membrane calcium AT ILPPEK#EGGLPR Transaldolase LIELYK#EAGISK Transmembrane protein 59 SKTEDHEEAGPLPTK#VNLAHSE ubiquitin and ribosomal protein LIFAGK#QLEDGR Uncharacterized protein C4orf3GSSLPGK#PTSPHNGQDPPAPP UV excision repair protein RADILNDDTALK#EYK Zinc finger ZZ-type and EF-hanKTDYFFLEVQK#R 40S ribosomal protein S2 AEDK#EWMPVTK 6-phosphofructokinase type C SFAGNLNTYK#R Cytosolic malate dehydrogenasSQGAALDK#YAK Glyceraldehyde-3-phosphate d VVK#QASEGPLK GTPase regulator associated wTITSALK#TYLR Plasma membrane calcium AT IEQEQK#FTVIR Rab GDP dissociation inhibitor K#QNDVFGEAEQ T-complex protein 1 subunit ze SVTLLIK#GPNK Vimentin TLLIK#TVETR Zinc finger ZZ-type and EF-hanKTDYFFLEVQK#R cDNA FLJ54710, highly similar EVK#YEAPQATDGLAGALDAR Isoform 1 of Disco-interacting pSK#LLSPYSPQTQETDSAVQK 40S ribosomal protein S2;40S AEDKEWMPVTK#LGR 6-phosphofructokinase, liver ty A]AVDLEK#LR Cell migration-inducing gene 10AEPAK#IEAFR Collapsin response mediator prK#PFPDFVYK FKBP1A protein;12 kDa FK506FMLGK#QEVIR Guanine nucleotide-binding proLK#IDFGDSAR Heat shock 70 kDa protein 1/2; GRLSK#EEIER Isoform 1 of Peptide-N(4)-(N-acDTINGLNK#QR Isoform 1 of Protein FAM115A IYLSK#GPNVK Solute carrier family 2, facilitateGTADVTHDLQEMK#EESR UPF0404 protein C11orf59 LLLDPSSPPTK#ALNGAEPNYHS cDNA FLJ54957, highly similar GITGVEDK#ESWHGKPLPK Isoform 1 of Cell surface glycopSDK#LPEEMGLLQGSSGDK Isoform 1 of Protein tweety homAK#YLATSQPRPDSSGSH Neutral amino acid transporter KGEQELAEVK#VEAIPNCK ubiquitin and ribosomal protein TITLEVEPSDTIENVK#AK#IQDK 6-phosphofructokinase type C NFGTK#ISAR B-CK;Creatine kinase B chain;CLPNLGK#HEK Calcium/calmodulin-dependent NLINQMLTINPAK#R Collapsin response mediator prK#PFPDFVYK Fructose-bisphosphate aldolas AAQEEYVK#R Fructose-bisphosphate aldolas K#ELSDIAHR Histone H2A type 1-H K#TESHHKAK Histone H2A type 2-B K#TESHKPGK Isoform 1 of Rab GTPase-bind DSISSYEAQITALK#QER Isoform 1 of Signal transducingDPGTVANK#K Isoform alpha-enolase of AlphaK#LNVTEQEK Isoform Long of Sodium/potassK#ADIGVAMGIAGSDVSK Isoform Long of Sodium/potassDMDELKK#EVSMDDHK Isoform Long of Sodium/potassSSK#IMESFK Isoform XB of Plasma membra TQDGVALEIQPLNSQEGIDNEEK Keratin, type II cytoskeletal 8 K#LLEGEESR Keratin, type II cytoskeletal 8 K#LLEGEESR Nucleoside diphosphate kinaseFMQASEDLLK#EHYVDLK Protein Ells1;UPF0452 protein K#TLHEVLEK ZW10 interactor EAFEQLQAK#K T-complex protein 1 subunit alpLHPESKDDK#HGSYEDAVHSGA cDNA FLJ55427, highly similar EVSMDDHK#LSLDELHR Isoform 1 of SEC23-interacting VVESPDFSK#DEDYLGK Isoform 2 of Probable E3 ubiquYK#DDADSPTEDGDKPR Neuronal-specific septin-3;Neu K#ELEVNGIEFYPQK ELAV (Embryonic lethal, abnor FANNPSQK#TNQAILSQLYQSPN Brain-specific membrane-anchoLK#LDLTKL cDNA FLJ55427, highly similar YQLSIHK#NPNTSEPQHLLVMK Cell migration-inducing gene 10IVK#DLMSK DNA repair protein complemen SLLPVKPVEIEIETPEQAK#TR Isoform 1 of Myb-binding prote LAATEK#LLEYLR Isoform 1 of Solute carrier fami ESK#GPIVPLNVADQK Isoform 1 of Solute carrier fami SPGTK#DVVVSVEYSK Isoform 2 of Peptidyl-glycine al AFGDSEHK#LETSSGR Isoform 2 of Probable ATP-depALVDALK#NWIEGNPK Leucine-rich repeat and fibroneLPTAK#GLEAGLDTPK L-lactate dehydrogenase TPK#IVSGK Malate dehydrogenase, cytoplaAK#AQIALK RCC1 and BTB domain-containNNLLSPAHIMVEK#ER Silent information regulator 2;NNLFSQTLSLGSQK#ER Tropomyosin 2 IVTNNLK#SLEAQADK E3 ubiquitin-protein ligase MIB SSEDATDDISSGNIPVLQK#DK Calcium/calmodulin-dependent DLINK#MLTINPAK Isoform CNPI of 2',3'-cyclic-nucMVSADAYK#ITPGAR MAP1 light chain LC1;Microtub TTSPPEVSGYSYEK#TER Plasma membrane calcium AT GEIEQERIDK#IWPK Plexin-A1;Semaphorin recepto QLLSDLIEK#NLESK Serine/threonine-protein kinaseGELK#LADFGLAR


92 92 92 92 92 92 92 92 92 92 92 92 92 91 92 91 92 92 91 91 91 91 91 91 91 91 91 91 90 90 90 90 90 90 90 90 90 90 90 90 89 89 89 89 89 89 89 89 89 89 89 89 89 89 88 89 89 88 89 89 88 89 89 88 89 89 88 88 88 88 88 87 88 87 88 87 88 87 87 88 88 87 88 88 87 87 87 86 86 86 86 86 86 86


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

O70593 F1M8R8 P04775 F1LMJ9 P60881 Q64568-10 D3ZHJ1 F1M7Y3 Q9EQS0 P23565 F1LV42 P63322 P28480 B0BN65 P12369 Q63488 Q6P791 P36407 P06686 P82471 P24942 Q62696 Q9JKB0 D4A0F5 F1LU03 P05708 P63004 Q07014 Q3KRC6 P13596 Q9JMB5 P63319 P36860 Q925B5 P46462 XP_001073579.1 Q810U0 Q64568-10 F1LRL9 G3V624 P09117 P24942 Q6AXQ5 Q5PQL7 Q6AY30 P43425 O88761 Q6AY41 P11506 P42123 P63102 P12839 P13233 Q68FP1 D3ZJR1 Q9EPT8 P62632 P59215 P82471 Q32Q05 P11506 Q64542-2 Q9EQS0 P05708 Q6AYA5 Q64568-10 P11506 G3V679 P06686 D3ZDH8 P11232 D3ZDH8 P63025 Q9ER24 G3V7G8 O88761 Q64568-10 P59215 Q9JKE3 Q64542-2 Q64542-2 P11506 P11506 Q64568-10 Q64566 P62762 P06687 NP_001099903.1 P62747 P06687 P24942 P61765 A0JPP7 P61265

Small glutamine-rich tetratrico AIGIDPGYSK#AYGR IPI:IPI00013949.1 Uncharacterized protein (Frag LLSPYSPQTQETDSTGQK#ER IPI00465045 IPI:IPI00002150.4 Sodium channel protein type 2GIDFVK#R Uncharacterized protein SQGSGLSSGGAGEGQGPK#K IPI:IPI00013452.9 SNAP25 IEEGMDQINK#DMK IPI:IPI00010438.2 Isoform ZE of Plasma membraNEK#GEIEQERLDK IPI:IPI00217169.1 Phosphoserine aminotransferaAVELNMISLK#GHR IPI:IPI00001734.3 IPI:IPI00424869.2 Uncharacterized protein (Frag NAK#LVER Transaldolase RIIELYK#EAGISK IPI:IPI00744692.1 Alpha-internexin AQYESLAAK#NLQSAEEWYK IPI:IPI00418471.6 Uncharacterized protein (Frag VLASNPIMESIGNAK#TTR IPI:IPI00016007.1 Ras-related protein Ral-A NRADQWNVNYVETSAK#TR IPI:IPI00217519.3 T-complex protein 1 subunit a DDK#HGGYENAVHSGALDD IPI:IPI00290566.1 IPI:IPI00303318.2 Family with sequence similarit HLNDESTSK#QIR cAMP-dependent protein kina LVK#EGEHVIDQGDDGDNFYVIDRIPI:IPI00063234.1 Sodium-dependent phosphateASDTSSAPEDSEK#LVGDTVSYS IPI:IPI00009504.2 Ragulator complex protein LA K#LLLDPSNTPTK IPI:IPI00016670.3 E3 ubiquitin-protein ligase TR A]ALAVNK#PGAGVDSGR IPI00003328 IPI00646182 Sodium/potassium-transportin EVAMDDHK#LSLDELGRK Guanine nucleotide-binding prEYQLSDSTK#YYLNDLDR IPI:IPI00305551.3 Excitatory amino acid transporK#PYQLIAQDNEPEKPVADSETK IPI:IPI00015473.3 SAP-97, disks large homolog QVTPDGESDEVGVIPSK#RRVEK IPI:IPI00218729.4 Potassium/sodium hyperpolar QFTSMLQPGVNK#FSLR IPI00218946 Septin-7 HEQMK#K IPI:IPI00029012.1 IPI:IPI00219018.7 Glyceraldehyde-3-phosphate dVVK#QASDSPLK Hexokinase-1 ATVK#MLPSFVR gi15553127 Platelet-activating factor acetyEEFTSGGPLGQK#RDPK IPI:IPI00218728.4 Tyrosine-protein kinase Lyn DNLNDDGVDMK#TQPVR IPI:IPI00298625.2 IPI:IPI00299404.1 Leucine-rich repeat-containingK#LVILR Neural cell adhesion moleculeDESK#EPIVEVR IPI:IPI00376427.4 IPI:IPI00033030.2 Proteasome 26S subunit, rpn1GSSTK#YLVEFR Protein kinase C gamma type SGENFDK#FFTR IPI00385449 Ras-related protein Ral-B AEEWGVQYVETSAK#TR IPI:IPI00217519.3 Synaptotagmin-13 K#GLLPR IPI:IPI00026089.3 VCP/p97 SRVAILK#ANLR IPI:IPI00022774.3 PREDICTED: DnaJ (Hsp40) hQVAEAYEVLSDAKK#R IPI:IPI00012535.1 Coiled-coil domain-containing K#LQEEELLATHMDIR IPI:IPI00383423.3 IPI:IPI00021695.1 Isoform ZE of Plasma membraIRNEK#GEIEQERLDK MAP1 light chain LC1 DLTGQVSTPPVK#QVK IPI00008868 IPI:IPI00798401.2 Similar to Coronin, actin bindinLEQQLAK#MAA Fructose-bisphosphate aldolasGILVGIK#VDK IPI:IPI00465439.5 Excitatory amino acid transporK#PYQLIAQDNEPEKPVADSETKMIPI:IPI00015473.3 2',5'-phosphodiesterase 12 LALNPLAQEK#VLQR IPI:IPI00174390.3 Integral membrane protein 2C ISFQPAVAGVK#AEK IPI:IPI00016014.1 IPI00329600 Saccharopine dehydrogenase SVSNLK#PVPVIGSK IPI:IPI00221232.9 Guanine nucleotide-binding prNDPLLVGVPASENPFK#DK 26S proteasome non-ATPase DSDSMETEEK#TAGAVAGK IPI:IPI00299608.3 Cell cycle control protein 50A DEVDGGPTGPPGGAAK#TR IPI:IPI00019381.4 Plasma membrane calcium-traLK#TSPVEGLPGTAPDLEK IPI:IPI00217169.1 IPI:IPI00219217.3 L-lactate dehydrogenase B ch EK#LIAPVADDETAVPNNK 14-3-3 protein zeta/delta, KCIPN@ELVQK#AK IPI00021263 Neurofilament medium polype AVEEMITITK#SVK IPI00217507 IPI00306667 2',3'-cyclic-nucleotide 3'-phospADFSEEYK#R Gelsolin TASDFISK#MQYPR IPI00026314 Similar to Epidermal growth faDPFAPSSSAK#PPK IPI:IPI00163849.2 Chloride intracellular channel LHVVK#IVAK IPI00001960 Elongation factor 1-alpha 2 SGGAGK#VTK IPI:IPI00396485.3 Guanine nucleotide-binding prEYQLNDSAK#YYLDSLDR IPI:IPI00305551.3 IPI:IPI00305551.3 Guanine nucleotide-binding prIPYK#YEHNK Ubiquitin thioesterase OTU1, YIDRFGEDAGYTK#R IPI:IPI00183503.8 Plasma membrane calcium-traK#ADVGFAMGIAGTDVAK IPI:IPI00006482.1 Isoform XA of Plasma membraLIRNEK#GEVEQEK IPI:IPI00217169.1 Transaldolase LAPTLSVK#AAQTSDLEK IPI:IPI00744692.1 Hexokinase-1 DYNPTASVK#MLPTFVR gi15553127 Transmembrane protein 106B SLSHLPLHSNK#EDGYDGVTSTD IPI:IPI00395903.1 IPI:IPI00217169.1 Isoform ZE of Plasma membraLK#TSPTEGLADNTNDLEK Plasma membrane calcium-traTSPVEGLPGTAPDLEK#RK IPI:IPI00217169.1 Transferrin receptor, isoform CLAADEEENADSNMK#ASVR IPI:IPI00022462.2 Sodium/potassium-transportin NSQTDK#LVNER IPI:IPI00006482.1 Septin 5, isoform CRA_d HTVDIEEK#GVK IPI:IPI00784614.1 Thioredoxin EK#LEATITEFA IPI:IPI00216298.6 Septin 5, isoform CRA_d ALHEK#VNIVPLIAK IPI00657797;IPI00790521 Vesicle-associated membraneVLERDQK#LSELDDR IPI:IPI00549343.3 Ataxin-10 IVGDEQLTK#DDISIFLR IPI:IPI00001636.1 Glycine-tRNA ligase (RCG525YPLFEGQETGK#KETVEE IPI:IPI00783097.3 26S proteasome non-ATPase TAGAVAGK#TPDASPEPK IPI:IPI00299608.3 Isoform ZE of Plasma membraTSPTEGLADNTNDLEK#R IPI:IPI00217169.1 Guanine nucleotide-binding prSREYQLNDSAK#YYLDSLDR IPI:IPI00305551.3 Secretory carrier-associated mGSGGSFSK#AQEEWTTGAWK IPI:IPI00056310.3 Isoform XA of Plasma membraLDK#VWPR IPI:IPI00217169.1 Isoform XA of Plasma membraSEMPEEK#LFK IPI:IPI00217169.1 Plasma membrane calcium-traSQMPEEK#LYK IPI:IPI00217169.1 Plasma membrane calcium-traQQDGAAAMEMQPLK#SAEGGDAIPI:IPI00021695.1 Isoform ZE of Plasma membraTSPTEGLADNTNDLEK#RR IPI:IPI00217169.1 Calcium-transporting ATPase TQK#NTTSTPSSFLEV IPI00745171 Visinin-like protein 1 QNSK#LAPEVMEDLVK IPI00219344 Sodium/potassium-transportin DLDDLKK#EVAMTEHK IPI:IPI00006482.1 spartin ELPK#EASGTDVR IPI:IPI00430622.1 Rho-related GTP-binding proteMK#QEPVRTDDGR IPI:IPI00478231.2 Sodium/potassium-transportin K#EVAMTEHK IPI:IPI00006482.1 Excitatory amino acid transporKPYQLIAQDNEPEK#PVADSETK IPI:IPI00015473.3 Syntaxin-binding protein 1 AVVGEK#IMHDVIKK IPI:IPI00019971.4 DDI1, DNA-damage inducible WAGVAK#GVGTQRIMGR IPI:IPI00845258.1 Syntaxin-1B QHSAILAAPNPDEK#TK IPI:IPI00221209.2

Small glutamine-rich tetratricopAICIDPAYSK#AYGR Disco-interacting protein 2 homLLSPYSPQTQETDSAVQK#ELR AP-4 complex subunit beta-1 LLLVGIDEVK#R Bifunctional aminoacyl-tRNA syNQGGGLSSSGAGEGQGPK#K Isoform SNAP-23a of SynaptosIEEGLDQINK#DMR Isoform XB of Plasma membra NEK#GEVEQEKLDK Phosphoserine aminotransfera ALELNMLSLK#GHR RAP1, GTP-GDP dissociation sNVK#LVER Transaldolase LIELYK#EAGISK Vimentin QQYESVAAK#NLQEAEEWYK Myosin-Vc VLASNPITEAVGNAK#TTR Ras-related protein Ral-A AEQWNVNYVETSAK#TR T-complex protein 1 subunit alpDDK#HGSYEDAVHSGALND Protein FAM49B HLNDETTSK#QIK Protein kinase, cAMP-dependeIVK#ADEHVIDQGDDGDNFYVIER Sodium-dependent phosphate AADSSAPEDSEK#LVGDTVSYSK UPF0404 protein C11orf59 K#LLLDPSSPPTK ADP-ribosylation factor domainA]TLVVNK#LGAGVDSGR cDNA FLJ55427, highly similar EVSMDDHK#LSLDELHR Guanine nucleotide-binding proEYQLSDSAK#YYLTDVDR Excitatory amino acid transport K#PYQLIAQDNETEK#PIDSETK Isoform 2 of Disks large homoloQVTPDGESDEVGVIPSK#R Brain cyclic nucleotide-gated chQFGALLQPGVNK#FSLR Eukaryotic translation initiation ILQEHEQIK#K Glyceraldehyde-3-phosphate d VVK#QASEGPLK hexokinase 2 pseudogene; hexGLGATTHPTAAVK#MLPTFVR Isoform 1 of Platelet-activating LNEAKEEFTSGGPLGQK#R Isoform LYN A of Tyrosine-protDSLSDDGVDLK#TQPVR Laminin subunit beta-3 QAGGGGGTGSPK#LVALR Neural cell adhesion molecule DGSK#EPIVEMR Proteasomal ubiquitin receptor GASNK#YLVEFR Protein kinase C alpha type;ProGAENFDK#FFTR Ras-related protein Ral-A AEQWNVNYVETSAK#TR Splicing factor 3B subunit 1 MTPPIK#DLLPR Transitional endoplasmic reticuVAILK#ANLR DnaJ homolog subfamily A me QISQAYEVLSDAKK#R Isoform 1 of Coiled-coil domainK#LQEEELLATQVDMR Isoform D of Plasma membraneIRNEK#GEIEQER MAP1 light chain LC1;Microtub DLTGQVPTPVVK#QTK cDNA FLJ50992, highly similar LEQQMAK#IAA Fructose-bisphosphate aldolas GGVVGIK#VDK Excitatory amino acid transport K#PYQLIAQDNETEK#PIDSETK Isoform 1 of 2',5'-phosphodiest LVLYPSAQEK#VLQR Isoform 1 of Integral membraneISFQPAVAGIK#GDK Probable saccharopine dehydroNVSNLK#PVPLIGPK Guanine nucleotide-binding proSDPLLIGIPTSENPFK#DK Isoform 1 of 26S proteasome n DSDSMETEEK#TSSAFVGK Isoform 1 of Cell cycle control pDEVDGGPPCAPGGTAK#TR Isoform XB of Plasma membra LK#TSPVEGLSGNPADLEK L-lactate dehydrogenase B chaEK#LIAPVAEEEATVPNNK 14-3-3 protein zeta/delta;Protei M]DKNELVQK#AK 160 kDa neurofilament protein; EEAVAEVVTITK#SVK 2',3'-cyclic-nucleotide 3'-phosphGAFSEEYK#R Actin-depolymerizing factor;AGTASDFITK#MDYPK cDNA FLJ60624, highly similar DPFVPSSAAK#PSK Chloride intracellular channel p LHIVK#VVAK Elongation factor 1-alpha 1 AAGAGK#VTK Guanine nucleotide-binding proEYQLSDSAK#YYLTDVDR Guanine nucleotide-binding proILYK#YEQNK Isoform 1 of Ubiquitin thioesteraFGEDAGYTK#R Isoform Long of Sodium/potassK#ADIGVAMGIAGSDVSK Isoform XB of Plasma membra NEK#GEVEQEKLDK Transaldolase LVPVLSAK#AAQASDLEK hexokinase 2 pseudogene; hexGLGATTHPTAAVK#MLPTFVR Transmembrane protein 106B SLSHLPLHSSK#EDAYDGVTSEN Isoform XB of Plasma membra LK#TSPVEGLSGNPADLEK Isoform XB of Plasma membra TSPVEGLSGNPADLEK#R Transferrin receptor protein 1 LAVDEEENADNNTK#ANVTKPK Isoform Long of Sodium/potassTDK#LVNER septin 9 isoform a SITHDIEEK#GVR Thioredoxin EK#LEATINELV LARP;Peanut-like protein 3;Se AVHEK#VNIIPVIGK Vesicle-associated membrane DQK#LSELDDRADALQAGASQFE Ataxin-10 ITSDEPLTK#DDIPVFLR Glycyl-tRNA synthetase YPLFEGQETGK#K Isoform 1 of 26S proteasome n TSSAFVGK#TPEASPEPK Isoform XB of Plasma membra TSPVEGLSGNPADLEK#R Guanine nucleotide-binding proEYQLSDSAK#YYLTDVDR Isoform 1 of Secretory carrier-aGAGGSFQK#AQTEWNTGTWR Isoform XB of Plasma membra LDK#IWPK Isoform XB of Plasma membra NEVPEEK#LYK Isoform XB of Plasma membra NEVPEEK#LYK Isoform D of Plasma membraneAQDGAAMEMQPLK#SEEGGDGD Isoform XB of Plasma membra TSPVEGLSGNPADLEK#R ATP-dependent Ca(2+) pump PIQK#HVSSTSSSFLEV Calcium-binding protein BDR-1QNSK#LRPEVLQDLR Isoform Long of Sodium/potassDMDELKK#EVSMDDHK Spartin TRPSSDQLK#EASGTDVK Transforming protein RhoA MK#QEPVKPEEGR Isoform Long of Sodium/potassDMDELKK#EVSMDDHK Excitatory amino acid transport DVEMGNSVIEENEMKKPYQLIAQ cDNA FLJ54775, highly similar AVVGEK#ILSGVIR Isoform 1 of Protein DDI1 homoWAGIAK#GVGTQK Isoform 1 of Syntaxin-2 NHSIILSAPNPEGK#IK


Page 58 of 60

86 85 86 84 85 85 85 86 85 84 83 83 83 83 83 83 83 82 82 82 82 82 81 83 82 82 81 81 83 82 82 82 81 83 82 80 80 80 80 80 80 78 79 79 79 78 78 78 78 78 78 77 78 77 77 78 78 76 78 77 76 77 76 75 72 72 72 72 73 73 73 71 71 71 71 71 71 68 68 71 70 70 67 67 67 67 67 67 67 67 64 64 63 63

Page 59 of 60

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60

P50878 Q6AZ42 P47860 Q9EQS0 P13596 D3ZDH8


60S ribosomal protein L4 KLEAAAAALAAK#SEK Gap junction protein RNEFK#DLEDIKR 6-phosphofructokinase type C ISAK#AMEWISAK Transaldolase DSSK#LAPTLSVK Neural cell adhesion moleculeAAFSKDESK#EPIVEVR Septin 5, isoform CRA_d ESAPFAVIGSNTVVEAK#GQR

IPI:IPI00003918.6 IPI:IPI00019868.2 IPI:IPI00219585.4 IPI:IPI00744692.1 IPI:IPI00376427.4 IPI00871851

60S ribosomal protein L4 AAAAAAALQAK#SDEK Gap junction beta-2 protein SEFK#DIEEIK Isoform 2 of 6-phosphofructokinMGAK#AMNWMSGK Transaldolase LLGELLQDNAK#LVPVLSAK Neural cell adhesion molecule DGSK#EPIVEMR Neural precursor cell expressedASIPFSVVGSNQLIEAK#GK


60 58 58 58 56 55


Table of contents synopsis (graphic presentation)



Rat Brain Ubiquitome Analysis 4 3 2 1 0 100 80

2+

3+

4+

5+

60 40 20 0 10


1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48

Page 60 of 60

1,500

15

20

25 SCX fractions

30

35

40

1413 1298 942

1,000

855


841

721

622

500

365

585 399

330 175

45

61

570

139

184

281 158

171

0 5-15

16

17

18

19 20 SCX fractions


21

22

23-29 30-40

Synaptic Protein Ubiquitination in Rat Brain Revealed by Antibody

Recommend Documents